(data stored in ACNUC7421 zone)

EMBL: CP000820.PE52

CP000820.PE52        Location/Qualifiers
FT   CDS_pept        complement(66165..67283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0053"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6341 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09521"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB60"
FT                   /protein_id="ABW09521.1"
FT                   /translation="MNPVALALACFFPLIGRPRLACQPLPDRVAEIAEIAQAAARDGAD
FT                   GLAEGAHALNKAALLASDCGLAPLARDLCWQHINIYCAVPRPLTVHEARYMLEPALNLA
FT                   RLQIRASDGEQALGLLTAMFQAVSSNTDLVVDGRVLPLTDLIGTRDERHKLREWVWLHL
FT                   VGDGVRALALAGRWDDAVIHADTYRGIGLHLLEGRQAKILAHCLTGTSAEARAALAEST
FT                   PMYPWELQVASCLEVMCTEDTSTAHGVTTMIGQFLGQRPMPGYAVFRAHLGMTVAALAA
FT                   TTDPDAATRVLTQTVEEVIEAEDGYAARDVLRLRPTQAVDLPARHEKALADLLNASGLR
FT                   AETPPEPVLESVLGSARTAEAAIVAATHPQRR"
     atgaaccccg tagccctggc tttggcctgc ttcttcccct tgatcggccg tccccgcctg        60
     gcctgtcagc ctctgcccga tcgagttgcg gagatcgccg agatcgccca agcggcggcc       120
     cgggacggtg cggacggact ggccgaagga gcacatgccc tgaacaaggc ggcgctgctc       180
     gccagcgact gcggtctggc gcccctcgcc cgtgacctgt gctggcagca catcaacatc       240
     tactgcgctg tcccgcgccc gctcaccgtc cacgaggccc gatacatgct cgaaccggcc       300
     ctcaacctcg cccggctcca gatccgcgcc agcgacgggg aacaggcgct cgggctactc       360
     accgcgatgt tccaggccgt ctcgtcgaac accgacctgg tcgtcgacgg ccgggtcctt       420
     ccgctgactg acctcatcgg cacccgcgac gagcgccaca agctgcgcga atgggtgtgg       480
     ctgcacctcg tcggggacgg cgtccgtgcc ctggcactcg ccggccgctg ggacgatgcg       540
     gtcatccacg cagacacgta ccgagggatc ggactgcatc tcctggaagg ccgccaggcg       600
     aagatcctcg ctcactgcct gaccgggacg tcagccgagg cccgcgcggc cctggcggag       660
     agcacgccga tgtacccgtg ggagctccag gtcgcctcgt gcctggaggt gatgtgcacc       720
     gaggacacat ccacagcaca cggtgtcacc accatgatcg ggcagttcct gggacaacga       780
     ccgatgcccg gctacgcggt cttccgtgcc cacctcggca tgaccgtagc cgctctcgcc       840
     gccaccaccg acccagacgc cgccacccgc gttctcaccc agacagtcga ggaagtgatc       900
     gaagccgagg acgggtacgc ggcacgggac gttctccggc ttcgccccac acaagcggtc       960
     gacctgccag ccaggcacga aaaggcgctc gccgacctac tcaacgcctc cggcctacga      1020
     gcagaaacac cgccggaacc ggtcctggag tctgttctcg gctccgcccg gaccgccgaa      1080
     gccgcgatcg tcgcggcgac acacccccag cgacgatga                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page