(data stored in ACNUC7421 zone)

EMBL: CP000820.PE524

CP000820.PE524       Location/Qualifiers
FT   CDS_pept        621210..621869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0533"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; sigma-70 region 4 domain protein; Sigma-70 region
FT                   4 type 2; KEGG: tfu:Tfu_0767 regulatory protein,
FT                   LuxR:response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09993"
FT                   /db_xref="GOA:A8KX90"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX90"
FT                   /protein_id="ABW09993.1"
FT                   /translation="MLLADDDGLVRSGLRALLDAEPDICVAAEAATGEEAVLAARSYRP
FT                   DVVLMDVRMPRRDGVWATSQITSWPHPRPRVLVLTTFDVDKVVEDALAAGADGFLLKRA
FT                   TPEQLIDGIRVVAGGDALVAPAVTRRLLVTLARRRVPDRELLTRADQLTDREAEVLRAL
FT                   AEGRSNTEIAAVLNLSVETVRTHVKRILSKLGVRDRTQAVVWAYRAGFVDMTAPGP"
     gtgctgctgg ccgacgacga cggcctggtg cgcagcgggc tgcgggcgtt gctggacgcc        60
     gagccggaca tctgtgtcgc cgccgaggcg gccaccggag aggaggcggt gctggcggca       120
     cgcagctacc ggcccgacgt cgtgctcatg gacgtgcgca tgccccgtcg ggacggagtc       180
     tgggcgacgt cccagatcac cagctggccg catcctcggc cgcgggtcct ggtgctgacc       240
     accttcgacg tcgacaaggt ggtcgaggac gccctcgccg ccggcgccga cggcttcctg       300
     ctcaagcggg ccacccctga gcagctgatc gacggcatcc gggtggtcgc cgggggcgac       360
     gcgctggtcg cccccgcggt gacccgccgg ctgctggtca cgctcgcccg ccgtcgcgtg       420
     cccgaccgcg agctgctgac gcgggccgac cagctgaccg accgggaggc ggaggtgctg       480
     cgggcactgg ccgagggcag gtcgaacacc gagatcgcgg ccgtcctgaa cctgtcggtc       540
     gagacggtcc gcacccacgt caagcggatc ctcagcaagc tgggtgtccg ggaccgcacc       600
     caggcggtgg tgtgggcgta ccgcgccggg ttcgtcgaca tgacggcccc cggcccctga       660
//

If you have problems or comments...

PBIL Back to PBIL home page