(data stored in ACNUC7421 zone)

EMBL: CP000820.PE525

CP000820.PE525       Location/Qualifiers
FT   CDS_pept        622605..622970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0535"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_4141 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09994"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX91"
FT                   /protein_id="ABW09994.1"
FT                   /translation="MGVSPHPRRTSSARHQDRTLHRVVDLERATVSSPSPNATTPPGPP
FT                   SYDPRHVRVLGATAHPTAAWVTQPARHQAMDPEDAGAQAKYLTRDRGSAFRWHTHHHAA
FT                   RHHHVAHLPVRSADEAP"
     atgggggtat ccccgcatcc acggcgaacc agcagcgctc ggcatcaaga tcgcaccctc        60
     caccgtgtgg tagatcttga aagagctaca gtatcgagcc cctccccgaa cgcgaccaca       120
     ccacctgggc cgccttccta cgatcccagg cacgtacggg tcctcggcgc cacagcgcac       180
     cccaccgccg cctgggtcac gcaacccgcc cggcaccagg ccatggaccc cgaagacgcg       240
     ggggcacagg caaaatatct gacccgcgac cgcggcagtg cgttccggtg gcacacccac       300
     caccacgccg cacgccatca ccacgtcgcc cacctaccag tacggtccgc ggacgaagca       360
     ccgtaa                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page