(data stored in ACNUC7421 zone)

EMBL: CP000820.PE526

CP000820.PE526       Location/Qualifiers
FT   CDS_pept        623083..623922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0536"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   fal:FRAAL2957 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09995"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX92"
FT                   /protein_id="ABW09995.1"
FT                   /translation="MSDTPTGHRRWKTLVDKVDRAELRTDAPHSARMYDYYLGGKDNFP
FT                   ADREGAEQAIAVFPTLRDAARENRAFLVRAIRYLASEVGIRQFLDIGTGIPTSPNLHEV
FT                   AQGIAPDARVVYADNDPIVLAHARALLTSTPEGRTVYLDADVRNVDQILAAPALRDTLD
FT                   LTRPVALSLLAVLPFVEGDAPYAIVRSFLDALPAGSYLVLSHGTADLDPSARRIETSYR
FT                   ERGLECQFRSRAEVERLFDGLTLVDPGVQVIHRWRPDGTAEHLSDAEVCGYCGVGRK"
     gtgagcgaca ctccgacggg tcaccgtcgc tggaagaccc tggtagacaa ggtggacagg        60
     gccgagctac ggaccgacgc cccgcactct gcgcgcatgt acgactacta tcttggcggg       120
     aaggataatt tcccggccga cagggaaggc gccgaacaag ccatcgccgt tttcccgact       180
     ttgcgtgatg ccgctcgaga gaaccgggcc ttcctggtcc gcgcgatccg gtatctggcc       240
     agtgaggtgg gcatccggca gttcctggac atcgggacgg gcatcccgac cagcccgaac       300
     ctgcacgagg tcgcccaggg catcgccccg gacgcccggg tggtctacgc cgacaacgac       360
     ccgatcgtcc ttgctcacgc ccgggcgttg ctgaccagca cccccgaagg gcgcactgtc       420
     tacctcgacg ccgatgtacg caacgttgat caaattctgg ccgccccggc gctgcgcgac       480
     accctcgatt tgacccgccc tgtcgcgctg tcgcttctcg cggtcttgcc ctttgtcgag       540
     ggcgacgcac cctacgccat cgtccgcagc ttcctcgatg ctcttcccgc tggcagctac       600
     ctcgttctca gtcacggcac cgccgacctc gatcccagcg ctcgacgcat cgagaccagc       660
     taccgtgagc ggggcctgga gtgccagttc cgtagccgcg cggaagtgga gcggctgttc       720
     gacggactga cgctggtcga tccaggagtg caggtcatcc accggtggcg ccctgacggc       780
     accgcggaac acctgtccga tgccgaggtc tgcggctact gcggggtagg acgcaagtag       840
//

If you have problems or comments...

PBIL Back to PBIL home page