(data stored in ACNUC7421 zone)

EMBL: CP000820.PE527

CP000820.PE527       Location/Qualifiers
FT   CDS_pept        624519..624797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09996"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX93"
FT                   /protein_id="ABW09996.1"
FT                   /translation="MDRWHKAGGAPAGRPVALHDYLGLGPIEYALWVERPSSLRFVTEA
FT                   RRAGRRVDDITGLASIAVEEANDDDAEAQRLVAWLRATRRIPTDHTG"
     gtggaccggt ggcacaaggc cggcggcgcg ccggctggtc gtcccgtcgc gctgcacgac        60
     tacctgggtc ttggacccat cgagtacgcc ctgtgggtgg agcggccgag ttcgttgcgg       120
     ttcgtcaccg aagcgcgcag ggccggtcga cgggtcgatg acatcaccgg actcgcctcg       180
     atcgcggtgg aggaggccaa cgacgacgac gcggaggcac agaggctggt cgcgtggtta       240
     cgtgcgacgc gccggattcc caccgaccac actggctga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page