(data stored in ACNUC7421 zone)

EMBL: CP000820.PE528

CP000820.PE528       Location/Qualifiers
FT   CDS_pept        complement(625110..625553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0538"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL0474 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09997"
FT                   /db_xref="GOA:A8KX94"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX94"
FT                   /protein_id="ABW09997.1"
FT                   /translation="MGVPADPGELLKLGHRVVDFFHVDCAVTLRRLYCFFVLDVGTRTV
FT                   HILGVTTHPDGPWTTQQARNLLMDLGARAADFQVLVRDRAGQFTASFDAVLAGAGITAV
FT                   KIPPRTPRTNAYAERFVRTVRTEVTGPACDGWVAMPPRSLPRT"
     atgggggtac cagcggatcc aggcgagctc ctcaagctcg gccaccgggt ggtcgacttc        60
     ttccatgtgg actgcgccgt gacgctgcgg cggttgtact gcttcttcgt cctggacgtc       120
     ggcacccgca ccgtccacat cctcggggtc accacccacc cggacggacc gtggaccacc       180
     cagcaagccc ggaacctcct gatggacctc ggcgcccggg cggccgactt ccaggtcctg       240
     gtccgtgacc gggccggcca gttcaccgca tcgttcgacg cggtcctcgc cggcgccggc       300
     atcaccgccg tcaagatccc accccgaacc ccgcggacga acgcctacgc tgagcggttc       360
     gtccgcacgg tccggaccga ggtcaccggt cctgcctgcg atggctgggt ggctatgccg       420
     ccgagatcgt tgccgcgtac atga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page