(data stored in ACNUC7421 zone)

EMBL: CP000820.PE529

CP000820.PE529       Location/Qualifiers
FT   CDS_pept        625581..625838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09998"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX95"
FT                   /protein_id="ABW09998.1"
FT                   /translation="MRVAISVLTGGRPVLWGWVHFRVIRRRCHRRTVPGVTGRCARSVL
FT                   GRTLISAASTARSAQSQRGLGWVRRSTATSCRRQTSGSDR"
     atgagggtcg cgatctccgt gctgaccggt ggtcgtcccg tcctgtgggg gtgggtccat        60
     ttccgtgtga tcagacggcg gtgccaccgc aggacggtgc cgggagtgac cggtcggtgc       120
     gctcgcagcg tcttggggag aaccctgatc agtgcggcga gcaccgcgcg gtccgcccag       180
     tcccagcgag gcttgggctg ggtacggcgc agcaccgcga cctcgtgccg ccgacagacg       240
     tccggctccg atcggtag                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page