(data stored in ACNUC7421 zone)

EMBL: CP000820.PE531

CP000820.PE531       Location/Qualifiers
FT   CDS_pept        626542..627879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0541"
FT                   /product="protein serine phosphatase with GAF(s) sensor(s)"
FT                   /note="PFAM: GAF domain protein; Stage II sporulation E
FT                   family protein; SMART: protein phosphatase 2C domain
FT                   protein; KEGG: fal:FRAAL5352 putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10000"
FT                   /db_xref="GOA:A8KX97"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX97"
FT                   /protein_id="ABW10000.1"
FT                   /translation="MDNAPAPEGTGPARDAGPDQAASVLLRAEPEEPFDRLTRLAAVML
FT                   GAPFAFVMAMDDGRSYWKSRAGTAAGDLTGRQIAAADSLCRLAVGTGLPLVVPDAGRDD
FT                   RVRGDSLVRSAGIRAWASFPLRDPSGRTLGAFGAADVRPRLWTARDLELLETLAQAVSG
FT                   EIALRHVAAAATALARTLQQSLLPPEVPEIPGLEVSARYRPAGEGAEVLGDFFDVFQTG
FT                   RTSFGVVLGDVAGKGVEAAKVTALAHYTIRAAASRTRDPAAILNQLNRALLTQHPDSER
FT                   FLTVAYMAVDRSRRNRTLALCSAGHTPVLLRGRDGTVTPIGSHGLVLGVFEDPELTTSR
FT                   PRFGPGDTILLYTDGVTEARRGNDQYGDDRLRALLAATDPAAGRLTATIEAAVLDFADG
FT                   PPQDDIAILAIHFPDISSVAMKTVRSRLRSRRRPRRPFTRRGTPTV"
     gtggataatg cgccggcgcc ggaagggacc gggccggcac gtgacgcggg ccccgaccag        60
     gctgcctcgg tattgctccg cgccgagccg gaggagccct tcgaccggct gacccgcctg       120
     gcggcagtca tgctcggcgc cccgttcgcc ttcgtcatgg cgatggacga cgggcgttcc       180
     tactggaagt cccgtgcggg tacggcggcg ggcgacctca ccggtcggca gatcgcagcg       240
     gcagacagcc tctgccgcct ggcggtcggc acgggtctgc cgctggtcgt gcccgatgcc       300
     ggccgcgacg atcgcgtccg gggcgattcg ctcgtccggt cggccggtat cagggcatgg       360
     gccagcttcc cgctccgcga tccgagcggc cgcacgctcg gtgccttcgg agcggccgac       420
     gtccgccccc ggctctggac ggcccgtgac ctcgagctgc tggagaccct cgcccaggcc       480
     gtgtcgggcg agatcgcgct gcgtcacgtc gcggcggccg cgaccgcgct ggcccggact       540
     ctccagcaga gcctcctccc cccggaggtt ccggagatcc ccggcctgga ggtctcggcc       600
     cgttaccgcc cggcgggcga aggcgccgag gtcctgggcg atttcttcga cgtgttccag       660
     accggccgta ccagtttcgg cgtggttctg ggcgatgtcg ccggcaaggg ggtcgaggcg       720
     gccaaggtga ccgcgctggc gcactacacc atccgggcgg cggcgagtcg cacccgtgat       780
     ccggccgcca ttctgaacca gctcaaccgg gcgctgctca cccaacatcc cgacagcgaa       840
     cggttcctca ccgtcgcata catggccgtg gaccggtccc ggcgaaatcg gaccctggcc       900
     ctctgttcgg ccgggcacac tcccgttctg ctccgtgggc gcgacggcac ggtgaccccc       960
     atcggctccc acggcctggt gctcggcgtc ttcgaggacc cggagctcac caccagccgg      1020
     ccgagattcg gtcccggtga caccatcctg ctctacacgg acggcgtcac cgaggcccgc      1080
     cgtgggaacg accagtacgg cgatgatcgg ctgcgggcgc tgctcgcggc caccgatccg      1140
     gccgccggcc gcctcaccgc gacgatcgag gcggcggtgc ttgattttgc cgacgggccg      1200
     ccccaggacg atattgccat cctcgcaatc cacttcccgg atatctcgtc cgtggcgatg      1260
     aaaacggtcc gttcgaggct gcggtcccgg cggcgaccac ggcggccgtt cacgcgccgt      1320
     ggcacgccga ccgtgtga                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page