(data stored in ACNUC7421 zone)

EMBL: CP000820.PE533

CP000820.PE533       Location/Qualifiers
FT   CDS_pept        629371..630387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0543"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL1701 hypothetical protein; putative
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10002"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX99"
FT                   /protein_id="ABW10002.1"
FT                   /translation="MSSAISFDHLFRLTDDIGLFEHALGSVPRREHGYCVDDVARGLVV
FT                   LTREPSPGVDLVRLLERYLAFVLAAQAVDGAVHNRRDSDGRWRDDPGLGDCWGRALWGL
FT                   GTAAASAPTRRLRASARAGFLASAGRRSPWPRAMTFAALGAGEVLLAHPDDEPARALLT
FT                   AAVEVIGPVGANPGWPWPEPTLRYANGAVPEALILAGMCLPDKVVLADGLRLLAWLLQV
FT                   ETRDGNLSPTPVGGRRPGGDPGPGFDQQPIEAAAIADACARAHAATGRKRWLTGLGRAH
FT                   GWFLGDNDSSMALLNPDTGGCYDGLEPGGRNLNQGAESTLALLSTTQHARRLLASTP"
     gtgagctccg cgatctcgtt cgaccacctg ttccggctca ccgacgacat cggactgttc        60
     gagcacgccc tcggttcggt gccacgccgg gagcacggct actgcgtgga cgacgtcgcg       120
     cgcgggctgg tcgtcctcac ccgcgagcca tcgcccgggg tggacctggt gcgcctgttg       180
     gagcgctacc tcgccttcgt gctggccgcg caggcggtgg acggcgccgt ccacaaccgg       240
     cgggacagcg acgggcggtg gcgggacgat cccggcctcg gtgactgctg gggccgggcg       300
     ctctgggggc tgggcaccgc ggccgcctcc gcgccgaccc ggcggttgcg ggcctcggcg       360
     cgggccggct tcctcgccag cgcggggcgc cgctcgccct ggccacgggc catgacgttc       420
     gccgcgctcg gtgccggaga ggtgctgctc gcccatccgg acgacgagcc ggcgcgcgcg       480
     ctgctcaccg ccgccgtcga ggtgatcgga ccggtcggcg ccaacccggg ctggccgtgg       540
     ccggagccca ccctgcgcta cgccaacggg gccgtcccgg aggcactgat ccttgccggg       600
     atgtgcctgc ccgacaaggt ggtgctcgcg gacggtctgc ggctgttggc gtggctgctc       660
     caggtggaga cccgtgacgg gaacctgtca ccgaccccgg tcggcggtcg ccggccgggg       720
     ggagatcccg ggcccggttt cgaccagcag cccatcgagg ccgcggcgat cgcggacgcc       780
     tgcgcccgcg cccacgcggc gaccggacgg aaaagatggc tgaccggcct cggccgcgcc       840
     cacgggtggt tcctcgggga caacgacagc tcgatggcgt tactcaaccc cgacaccggc       900
     ggctgttacg acgggctcga gcccggcggc cgcaacctca accagggcgc cgaatcgacg       960
     ctcgccctgc tctccacgac ccagcacgcc cgccgcctcc tggcatcgac gccttga         1017
//

If you have problems or comments...

PBIL Back to PBIL home page