(data stored in ACNUC7421 zone)

EMBL: CP000820.PE536

CP000820.PE536       Location/Qualifiers
FT   CDS_pept        complement(632937..633494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0546"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL1786 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10005"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXA2"
FT                   /protein_id="ABW10005.1"
FT                   /translation="MAAGQMISFLDRADFARFDDDGGAPTRLRVASADACPEAPTGDRG
FT                   LRLSLAPAGGRGSFDGVWWPHSRRLDREAPALVAALSAAGHPISRLAVNGDVWTGIPRR
FT                   LSQPTRPPVRISWFRTLDPHTVTLDGGNRPRFFLLVIPPDTAADVAADALRMAAAGGLS
FT                   GPSGQILRHAGAVPLGARSGAP"
     atggcggcag gccagatgat ttcttttctc gatcgtgccg atttcgcgcg ttttgacgac        60
     gacggcggcg caccaacccg gcttcgcgtg gcctcggcgg acgcctgccc cgaagctccc       120
     accggtgacc gtgggctacg gctctccctc gctcccgccg gcggccgcgg atccttcgac       180
     ggagtctggt ggccacacag ccggcggctg gaccgtgagg ctccagcgct cgtcgcggcg       240
     ctgtccgccg ccggtcaccc gatcagccga ctggcggtca acggtgacgt ctggaccggt       300
     atcccccgca ggctttccca gccgacccgc ccaccggtgc ggatcagctg gttccgcacc       360
     ctcgatccgc acacggtcac cctggacggc ggcaaccgcc ccaggttctt tctcctcgtg       420
     atcccgcccg acacggccgc ggacgtggca gccgatgccc tccggatggc cgcggccggc       480
     gggctgtccg ggccgtccgg ccagatcctg cgccacgcgg gcgccgtgcc gctcggcgcc       540
     cggtccggag cgccgtga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page