(data stored in ACNUC7421 zone)

EMBL: CP000820.PE542

CP000820.PE542       Location/Qualifiers
FT   CDS_pept        complement(638792..639175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0552"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   stp:Strop_3106 PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10011"
FT                   /db_xref="GOA:A8KXA8"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXA8"
FT                   /protein_id="ABW10011.1"
FT                   /translation="MNRGVLDTSVLVATDVTPIPGELAVSVISIAELQFGILVAKTPQA
FT                   RATRLARLSTIQRRFDPLPIDDAVADSYGRLAARVVEAGRQPRARTMDLLIAATAHAHG
FT                   ASIYTRNAADLAGLEDLLRIVTI"
     atgaatcgcg gcgtcctcga caccagtgtc ctggtcgcca cggacgtcac cccaatcccc        60
     ggcgagttgg cagtcagcgt catcagcatc gccgaactac agttcggcat cctcgtcgcc       120
     aagacacccc aggcccgcgc aacccggctc gcccgcctca gcacgatcca gcgacggttc       180
     gacccgctgc ccatcgacga cgccgtcgcc gacagctacg gacgtctcgc cgcccgcgtc       240
     gtcgaagccg gacgccagcc acgcgcacgc acgatggacc tgctgatcgc ggccaccgca       300
     cacgcccacg gagccagcat ctacacccgc aacgccgccg acctcgccgg cttggaagac       360
     ctcctcagga tcgtaacgat ctag                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page