(data stored in ACNUC7421 zone)

EMBL: CP000820.PE543

CP000820.PE543       Location/Qualifiers
FT   CDS_pept        complement(639172..639420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0553"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; KEGG:
FT                   stp:Strop_3107 prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10012"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXA9"
FT                   /protein_id="ABW10012.1"
FT                   /translation="MDEIGLREVRQNASDLVRRAQAGERLTITVAGRPAAVLGPVSPRV
FT                   WRHWDDLAELFAQPEDTDWPEDRNLVDGSLTDPWESR"
     gtggacgaga tagggcttcg agaggtccgg cagaacgcca gcgacctggt acgacgcgcc        60
     caggccggtg aacggctcac catcaccgtg gccggccgac cagcagccgt cctcggcccg       120
     gtgagtccgc gcgtgtggcg gcactgggac gacctggcag aactcttcgc acagccggag       180
     gacaccgact ggcctgagga ccgcaacctc gtcgacggtt ccctcacaga tccctgggaa       240
     agccgatga                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page