(data stored in ACNUC7421 zone)

EMBL: CP000820.PE545

CP000820.PE545       Location/Qualifiers
FT   CDS_pept        complement(640412..641632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0555"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL3467 hypothetical protein; putative
FT                   signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10014"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXB1"
FT                   /protein_id="ABW10014.1"
FT                   /translation="MFLGRLSARLLGGAAAAILTVAVTGCSASGDGGKAEAAACNSPGV
FT                   TANQINLGLVVTDSGPGSAAFDSARSGVDARIGLANQEGGIHGRRIVYQWRDDANSPPQ
FT                   NANVTTNLVQQDSIFGLVTATAALGDSLDGLAAQKVPIVGFAQPDWGKYQNFFTYLYAA
FT                   SPDTIGRYIQASGGTKVAFVTTGASAFTLQVMARYQAAFQAIGLGTTDAISYASSTDSP
FT                   ARVVQQISAAGADSMIGFTTSGDFAAIAQAARAAHLDLSSSVALTGYDHSLLATLGPAL
FT                   SGVSFPVYFRPFEAGGAAIDRYRAAMARFAPETFVPEQQFAMHAYIYTDMFLRGLELAG
FT                   SCPTREGFISALRKVSDYDAGGLIAPIDLSNNASQPLNCYAFVKINPAGNAFQVVHERL
FT                   CADGTGT"
     atgttcctgg gtagattatc ggcgaggttg ctggggggcg cggcggccgc gattcttacg        60
     gttgccgtga ccggctgttc cgcgtcggga gacggcggca aggcggaggc cgctgcctgc       120
     aacagccccg gcgtcaccgc caaccagata aatcttggcc tcgtggtcac cgactcgggt       180
     cccggcagcg ccgcgttcga ctcggcccgc tccggtgtcg acgccaggat cgggttggcc       240
     aatcaggaag gcggcataca cggccgtcgg atcgtctacc agtggcgtga cgacgcgaac       300
     tcccccccgc agaacgccaa cgtcaccacg aacctcgtcc agcaggactc gatcttcggc       360
     ctggtgacgg ccaccgccgc gctcggggac tcgttggacg gccttgccgc gcagaaagtc       420
     cccattgtcg gcttcgctca gccggactgg ggtaaatacc agaacttctt cacctatctg       480
     tacgcagcgt cacccgacac catcggccgc tacatccagg ccagcggtgg aacaaaggtc       540
     gccttcgtga ccacgggggc gtcggccttc acgctgcagg tcatggcgcg ataccaggcc       600
     gccttccaag cgatcggtct cggtacgacc gacgcgatct cctatgcaag cagcacagac       660
     agcccggccc gggtggtcca gcagatatcg gccgccggcg ccgactccat gattggtttc       720
     acgacctcgg gggacttcgc cgcgatcgcg caggccgccc gcgcggcgca cctggacctc       780
     tccagcagcg tcgcgctcac cgggtacgac cacagcctgc tcgccacgct gggcccggca       840
     ctctccggtg tctcgttccc cgtctacttc cggcccttcg aggccggggg cgcggccatc       900
     gaccgctacc gcgcggcgat ggcccgcttt gcgccggaga cgttcgtccc cgaacagcag       960
     ttcgccatgc acgcctacat ctacactgac atgttccttc gcggcctcga actggccggt      1020
     tcctgcccca cccgcgaggg attcatcagc gcgctacgga aggtctccga ctacgacgcg      1080
     ggcggcctga tcgcgccgat agacctcagt aacaacgcca gccagccgct caactgctac      1140
     gccttcgtca agatcaaccc ggccggaaac gcattccagg tcgtccacga acgcctctgc      1200
     gccgacggca cgggcaccta a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page