(data stored in ACNUC7421 zone)

EMBL: CP000820.PE550

CP000820.PE550       Location/Qualifiers
FT   CDS_pept        complement(644304..644507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0560"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: sco:SCO4505 cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10019"
FT                   /db_xref="GOA:A8KXB6"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXB6"
FT                   /protein_id="ABW10019.1"
FT                   /translation="MAQGTVKWFNGEKGFGFIAQDGGGPDVFVHYSAIDSAGFRSLDEN
FT                   QRVEFDVTQGQKGPQAEHVRPV"
     atggctcagg gcactgtcaa gtggttcaac ggcgaaaagg gcttcgggtt catcgcgcag        60
     gacggcggcg gcccggacgt tttcgttcac tactcggcga tcgacagcgc gggcttccgt       120
     agcctggacg agaaccagcg cgtggagttc gatgtcacgc agggccagaa gggcccgcag       180
     gcggagcacg tccgcccggt ctga                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page