(data stored in ACNUC7421 zone)

EMBL: CP000820.PE553

CP000820.PE553       Location/Qualifiers
FT   CDS_pept        complement(647569..647967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0563"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: fal:FRAAL3368
FT                   putative ArsR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10022"
FT                   /db_xref="GOA:A8KXB9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXB9"
FT                   /protein_id="ABW10022.1"
FT                   /translation="MATTSPPATLPVTETTGDHSSSLAETIAACCTPLARAPLSAEEAD
FT                   KLVAVLKAIAVPARLRLLSMIYARDGGEACVCELTEPLGLTQPTISHHLKVLVDAGLIT
FT                   RDKRGVWAYYRAVPEALAALATVFSPPQ"
     atggcgacca cctccccacc ggcgaccctc cccgtcaccg agaccacggg cgaccactcg        60
     tccagcctcg cggagacgat cgccgcctgc tgcaccccgc tggcccgcgc accactgtcc       120
     gccgaggaag ccgacaagct ggtcgccgtc ctcaaggcca tcgccgtccc cgcccggcta       180
     cgacttctgt cgatgatcta cgcacgggac ggcggcgaag cctgcgtctg cgaactcacc       240
     gaacccctcg gcctcaccca acccaccatc agccaccacc tcaaagtcct cgtcgacgcc       300
     ggcctgatca cccgcgacaa acgcggcgtc tgggcctact accgcgccgt acccgaagca       360
     ctcgccgccc tcgccaccgt gttcagccca ccccaatag                              399
//

If you have problems or comments...

PBIL Back to PBIL home page