(data stored in ACNUC7421 zone)

EMBL: CP000820.PE559

CP000820.PE559       Location/Qualifiers
FT   CDS_pept        655376..655804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0569"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   fal:FRAAL2957 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10028"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXC5"
FT                   /protein_id="ABW10028.1"
FT                   /translation="MTDADADAGAGASSARRWFTPVTEQLTPADLKIDVSHSARVYDYF
FT                   LGGKDNFPADREAAEQTLAIFPDMRTGARENRAFLHRATRKLVRELGLRQFLDIGTGIP
FT                   TSPNLHEVAQEAAADARIVYADNDPIVLAQFQAPHQHL"
     gtgaccgatg ccgatgccga tgccggggcc ggggcgtcca gcgcgaggcg gtggttcacg        60
     cctgtgacgg aacagctcac cccggccgat ctgaagatcg atgtttcgca ctcggctcgg       120
     gtgtacgact atttcctggg tggtaaggac aacttcccgg ctgaccggga ggccgccgag       180
     cagacgctgg ccatcttccc ggacatgcgg accggggcgc gtgagaaccg ggcgttcctg       240
     caccgcgcga cccggaaact cgtcagggag ctggggctgc ggcagttcct cgacatcggc       300
     accggcatcc cgacctcgcc gaacctgcac gaggtcgcgc aggaggccgc cgcggacgcc       360
     cggatcgtct acgccgacaa cgatccgatc gtgctggcgc agtttcaggc gcctcaccag       420
     catctttag                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page