(data stored in ACNUC7421 zone)

EMBL: CP000820.PE56

CP000820.PE56        Location/Qualifiers
FT   CDS_pept        complement(72610..72801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6345 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09525"
FT                   /db_xref="InterPro:IPR027575"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB64"
FT                   /protein_id="ABW09525.1"
FT                   /translation="MSPVLMADQTESVDFALDDAELELDMRVVESTTRIAIMMCDTSDG
FT                   CGNSCSTSACNTSSNDPS"
     atgtcgccgg tgctgatggc cgaccagacg gagtccgtgg acttcgccct cgacgacgcg        60
     gagttggagc tcgacatgcg agtggtggag tccaccaccc gcatcgcgat catgatgtgc       120
     gacacgagcg atgggtgcgg caacagctgc agcaccagcg cgtgcaacac ctcctccaac       180
     gacccgtcct ga                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page