(data stored in ACNUC7421 zone)

EMBL: CP000820.PE562

CP000820.PE562       Location/Qualifiers
FT   CDS_pept        complement(658712..659566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0572"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbt:BBta_6987 putative exported protein of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10031"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXC8"
FT                   /protein_id="ABW10031.1"
FT                   /translation="MPRLFGWLAALAAAIVVTAILGPAPPASAGEYGPDTCRQGWVWRE
FT                   AVPGDHVCVTPQTRNQTWADNAQAANRREPAGGPYGPDTCRQGWVWREAVPGDHVCVTP
FT                   QTRSQAWADNAQAASRVAPDIPPPCRAVGGLPSDRGIPKQVVRCSVSGYWRATFTAFVH
FT                   DYTIFGSDAGSSVRVEHFENGSWVERPARMISVHNEYSARRAGEAGNTDCPVFGSMTGR
FT                   CWVPPAPRDCRIENASSIDCRDYAIGTPFSGINLNARSVRSTGSLTFGNGQFTTLPLVA
FT                   DSF"
     atgccacgac tgttcggctg gcttgccgcg ctcgcggcgg ccattgtagt gaccgcgatt        60
     ctcgggcccg ctccgccggc atctgcgggc gagtacggtc cggacacctg ccgccagggc       120
     tgggtgtggc gtgaggcggt tcccggcgac cacgtctgcg tgaccccgca gacccgcaac       180
     cagacgtggg cggacaacgc ccaggcggcc aaccggcgtg aaccggcagg cggcccgtac       240
     ggtccggaca cctgccgcca gggctgggtg tggcgtgagg cggttcccgg cgaccacgtc       300
     tgcgtgaccc cgcagacccg cagccaggcg tgggcggaca acgcccaggc cgcgtcccga       360
     gttgcgcctg acattcctcc gccgtgccgg gcggtcggcg ggctgccgtc ggacaggggc       420
     atacccaaac aggtcgtgcg ctgttccgtg agcggctact ggcgggcgac cttcaccgcc       480
     ttcgtgcacg actacacgat cttcgggtcg gacgccggct cgtcggtcag ggtcgagcat       540
     ttcgagaatg gcagctgggt cgaacggcca gcccggatga tcagcgtgca caacgagtac       600
     agcgcacgcc gcgccggcga ggccggcaac accgactgtc ccgtgttcgg ctcgatgacc       660
     ggacggtgct gggtgccacc ggcacccagg gactgccgca tcgagaacgc cagcagtatc       720
     gactgccggg actacgccat cggcacaccg ttctccggca tcaatctgaa cgcccgttcg       780
     gtgcgcagca caggatccct gaccttcggt aacgggcagt tcaccaccct gccgctggtc       840
     gccgattcat tctga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page