(data stored in ACNUC7421 zone)

EMBL: CP000820.PE564

CP000820.PE564       Location/Qualifiers
FT   CDS_pept        665803..666447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0574"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   fal:FRAAL0617 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10033"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXD0"
FT                   /protein_id="ABW10033.1"
FT                   /translation="MRQPARFCRWRPSAAGGGSPAVGAGRGGVCTAGRRARPLGLVIGV
FT                   CNQGVVPIVLAHARALLTGTRQGRTAYLDADLREPEKILASPELAETLDLDRPLVLSLI
FT                   AVLHFIPESDDPYGLVRRYTEVLPSGSYVALTHATGDFAPEEAERVSAVYQARGIALTP
FT                   RSRGGVEGFLTGLDLVEPGVVPVHRWHAEMDAGEELADSRVNVYGAIARVP"
     ttgaggcagc cggcgcggtt ctgtcgatgg cgcccctcag ccgcaggcgg cggttcgccg        60
     gcggtcggcg cgggccgcgg tggtgtctgc acggccggca gacgggcccg gccgcttggc       120
     ctcgtcattg gcgtgtgcaa ccaaggggtg gtaccgatcg tcctcgcgca cgcccgcgcc       180
     ctgctgaccg gtacccggca gggccgcacc gcctacctcg acgccgacct gcgcgagccg       240
     gagaagatcc tcgcctcgcc cgaactggcc gagactctcg acctcgaccg gccgctcgtg       300
     ctctccctga tcgccgtgct gcacttcatc cctgagtcgg acgacccgta cggcctggtc       360
     cgccgttaca cggaggtcct cccgtcgggc agctacgtgg cgctcaccca cgccaccggg       420
     gacttcgcgc cggaggaggc ggagcgggtc tcggccgtct accaggcacg cgggatcgcg       480
     ctgaccccac gctcccgggg cggggtcgag ggcttcctca ccggcctcga cctcgtcgag       540
     ccgggtgtcg tgccggtcca ccgctggcac gccgagatgg acgccgggga ggaactggcc       600
     gacagccgcg tcaacgtcta cggcgccatc gcccgcgtcc cctag                       645
//

If you have problems or comments...

PBIL Back to PBIL home page