(data stored in ACNUC7421 zone)

EMBL: CP000820.PE565

CP000820.PE565       Location/Qualifiers
FT   CDS_pept        complement(666727..668487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0575"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: fal:FRAAL5548 hypothetical
FT                   protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10034"
FT                   /db_xref="GOA:A8KXD1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXD1"
FT                   /protein_id="ABW10034.1"
FT                   /translation="MPELRNVVVSAHSPWRLTGSGRTPRVLRCAIAASLALLGLDVAFA
FT                   VLLDLRSARVATDLVSTAAQFAAAAACFWTARRVRGAERRWRVLIGLTAAGAMLASLSI
FT                   APTLLAGDLPHRQGMSPAYAVFLSLYGVALAGLLSLPTDPVDSRGGSAGRRWYGAHRWY
FT                   AITLLDCLLIAGSLVLLQWGTVLSAVVQTGPDIRPFRLALTHQGAGLILATAVVLIASF
FT                   RRPRAPATLALLGTGLLAYGLTTNIISYVAAEYGFHLPPWGLIGFALAYLLVFLAAFVP
FT                   VPTRTPPEGPAPPSPRAMWAHAALPYAALTAAGLLILGKLATGARLDRFETYGMITLLV
FT                   LALLRQMVTLAENTRLLAEIRERERQLHHQAFHDPLTGLANRTLFTRRLQRALTQGTDS
FT                   DTTHTPAITSGEDTVSVLFLDLDGFKKVNDTFGHAVGDELLQISADRLRAETRAIDTVA
FT                   RLGGDEFGVILDGGGPDDPRRIGERLATAVQAPCLLAGRPYTPRASLGLVTLDSTTTRP
FT                   ATPDILIHQADLAMYTAKRTQTGGLVIYQPDPSTPTTTTNHHPDHPTRSVESSVCGFRD
FT                   RPAHDPGPVP"
     atgcctgaac tccgcaacgt cgtcgtttct gcacatagtc cgtggcgtct gaccggttcg        60
     ggccgtacgc cacgagtgtt gcggtgcgcc atcgccgcct ccctggcgct gctggggctg       120
     gatgtcgcct tcgcggtgct gctggacctg cgctccgccc gcgtcgccac ggacctcgtc       180
     tccaccgcag cccagttcgc cgccgcggcc gcctgtttct ggaccgcccg gcgggtacgc       240
     ggggcggagc gccgctggcg ggtgctcatc ggtctcaccg ccgccggagc gatgctcgcc       300
     agcctctcga tcgcaccgac gttgctggcc ggagacctgc cccacaggca aggcatgtcc       360
     ccggcgtatg ccgtcttcct ctccctctac ggggtggccc tggccgggct gctgtccctg       420
     cccaccgacc cggtggacag ccggggcggg agtgctggca ggcgatggta cggcgcccac       480
     cgctggtatg cgatcaccct gctggactgc ctgctgatcg ccggctcgct cgtcctgctg       540
     caatggggga cggtgctctc cgcggtcgtc cagacgggcc ccgacatcag accattccgg       600
     ctcgccctga cccaccaggg tgccggcctg atcctcgcca ccgcggtcgt gctgatcgcc       660
     agcttccgcc gaccccgcgc ccccgcaacg ctggcactac tgggcaccgg cctgctggcc       720
     tacggactca ccaccaacat catctcctac gtcgccgcgg agtacgggtt ccacctgccg       780
     ccctggggcc tgatcgggtt cgctctcgcc tacctgctgg tcttcctcgc cgcgttcgtc       840
     ccggtcccga cccgcacgcc ccccgagggc cccgccccgc ccagcccgcg ggcgatgtgg       900
     gcacacgccg cgctgcccta cgccgcgctc accgccgcgg gcctgctgat cctgggcaag       960
     ctggccaccg gtgcccgcct cgaccggttc gagacctacg gcatgatcac actgctggtg      1020
     ctcgccctgc tccggcagat ggtcaccctc gcagagaaca cccggctact cgccgagatc      1080
     cgggaacgcg aacggcaact gcaccaccag gcgttccacg acccgctgac cggcctggcc      1140
     aaccggacac tgttcacccg ccggctgcaa cgagccctca cccaaggcac cgacagcgac      1200
     accacccaca cccccgccat cacctccggc gaggacacgg tgtccgtcct gttcctcgac      1260
     cttgacggct tcaaaaaggt gaacgacacg ttcggccacg ccgtcggcga cgaactcctc      1320
     cagatcagcg ccgaccggct acgcgcggaa acccgcgcga tcgacaccgt cgcccgcctc      1380
     ggcggcgacg agttcggcgt catcctcgac ggcggcggcc ccgacgaccc ccgccgcatc      1440
     ggcgaacggc tcgccaccgc cgtccaggcc ccctgcctgc tggcggggcg gccttacacc      1500
     ccccgcgcca gcctcggcct ggtcaccctc gacagcacca ccacccgacc cgccaccccc      1560
     gacatcctga tccaccaggc cgacctggcc atgtacaccg ccaaacgcac acaaaccggc      1620
     ggactcgtca tctaccaacc cgacccgtcc acccccacga ccaccaccaa ccatcatccc      1680
     gaccacccga cacgatcggt tgaaagttcg gtttgtgggt ttcgggaccg cccggcgcac      1740
     gatccgggtc ccgttccgtg a                                                1761
//

If you have problems or comments...

PBIL Back to PBIL home page