(data stored in ACNUC7421 zone)

EMBL: CP000820.PE566

CP000820.PE566       Location/Qualifiers
FT   CDS_pept        complement(668480..668725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10035"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXD2"
FT                   /protein_id="ABW10035.1"
FT                   /translation="MSPAITACTPPPADRRQRRQDVSLPATPASPQPAATAPRYSRSVT
FT                   TFAVTEPSLFTPPSPNRHCTNLNDCDTLPCGGVGDA"
     atgtcacctg cgatcacagc gtgcacacct ccaccagccg accgccgaca gcgtaggcag        60
     gacgtcagcc tgccagcgac gccagcatcg ccgcagcccg cggcgactgc accccgctac       120
     agccgctccg tcacgacgtt cgccgtgacg gagccctcct tgttcacccc accctcgccg       180
     aatcgtcact gtacgaatct aaatgattgc gatacgcttc cttgtggggg tgtgggtgat       240
     gcctga                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page