(data stored in ACNUC7421 zone)

EMBL: CP000820.PE568

CP000820.PE568       Location/Qualifiers
FT   CDS_pept        complement(670881..671684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0578"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; Tetracyclin repressor
FT                   domain protein; KEGG: psb:Psyr_2378 regulatory protein,
FT                   TetR:Tetracyclin repressor, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10037"
FT                   /db_xref="GOA:A8KXD4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR003012"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXD4"
FT                   /protein_id="ABW10037.1"
FT                   /translation="MTSSPPAVTDSLRSPAHDDGAAPTEETAVPAEPGSARWWAERALV
FT                   DRRRRPRAGGLSTERIVETALEILREEGLEALTVRSVAERLGTSNASLYRHIASRDELI
FT                   ALIADHVMGDIRLDRTGRGWRADVEALMFEMRRVILSQPLPPSAGRSKSGSGSGPNMLR
FT                   LVEFALALYREAGLTDRQAVYTTITMIEFVGGSTNIRRSPAGRGSNGVAGAADLRQLLD
FT                   GLPADDFPALRTAGNLYTAASADDVFTHGMTLFLDGVASQLPSSQ"
     gtgacatctt caccacccgc ggtgaccgat agtctccggt cgcctgctca cgacgacgga        60
     gccgcaccga ccgaggagac ggcagtaccc gctgagcccg gatccgcccg ctggtgggcg       120
     gagcgcgccc tggtcgaccg tcgccgcagg ccgcgagccg gcggactgtc caccgaacgc       180
     atcgtcgaga cggccctgga gatcctccgt gaggaaggac tggaagcgct gaccgtgcgc       240
     tcggtcgccg aacggctcgg caccagcaac gcctcgcttt accggcacat cgccagccgc       300
     gacgagctga tcgccctcat cgccgaccac gtgatgggcg acatccgact cgatcgcacc       360
     ggccgcggct ggcgcgccga cgtcgaggcg ctgatgttcg agatgcgcag ggtcatcctc       420
     agccagccgc tgcccccgtc ggctgggcgg agcaaatcgg gatccggatc ggggccgaac       480
     atgctgcgcc tcgtcgaatt cgccctcgcc ctgtaccgcg aggccggact gaccgacaga       540
     caggcggtct acacgaccat aacgatgatc gagttcgttg gcggttccac caacatccga       600
     cgcagccccg ccggtcgcgg ctcgaacgga gtggccggag cagccgacct gcgtcaactt       660
     ctcgacggac tacccgccga cgacttcccg gcgctacgta cggccgggaa tctctacacc       720
     gccgcctccg ccgacgacgt cttcactcac ggcatgaccc tcttcctcga cggcgtcgcc       780
     agccaactcc ccagcagtca ataa                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page