(data stored in ACNUC7421 zone)

EMBL: CP000820.PE569

CP000820.PE569       Location/Qualifiers
FT   CDS_pept        671804..672259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10038"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXD5"
FT                   /protein_id="ABW10038.1"
FT                   /translation="MCLPTWVPTAGHESGGVPRRRRRRTLAGRMTRPTPATTHPADRQT
FT                   SCLLPTRAIWPAPSAFSGHHRKGFSARPAEQAGDLRLDLRQPAGKIPRPTSSVDFAGAP
FT                   AGRAPHRRPRRAHQRAGNPPRRKGDPPIPAYTMWPVTVTGDEAGECS"
     ttgtgtctac cgacatgggt cccaaccgcc ggccacgaga gcggcggggt accgcgccga        60
     cgtcgtcgcc gcaccctggc tggtcgcatg accaggccca cccccgccac cacccacccg       120
     gctgaccggc aaacgtcatg ccttctcccg acgcgcgcca tctggcccgc gccgtcggcg       180
     ttctccggac atcaccggaa aggcttctcc gcccggcccg ccgaacaggc aggcgacctt       240
     cggcttgatc tcaggcagcc cgccgggaag attccgcgcc caaccagctc ggtggatttc       300
     gccggtgccc cggccggcag ggctcctcac cgccgcccgc ggcgcgccca ccagcgcgca       360
     gggaatccac ccaggcgaaa aggtgatccg ccgatccccg cgtacacgat gtggccggtg       420
     accgtcaccg gcgatgaggc aggagagtgt tcatga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page