(data stored in ACNUC7421 zone)

EMBL: CP000820.PE57

CP000820.PE57        Location/Qualifiers
FT   CDS_pept        complement(72866..74167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0058"
FT                   /product="Protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="PFAM: protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase; KEGG: fal:FRAAL6346 putative protein;
FT                   putative O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09526"
FT                   /db_xref="GOA:A8LB65"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR027573"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB65"
FT                   /protein_id="ABW09526.1"
FT                   /translation="MFRLWRRETGARPPEGSSLIQMIGTSSAPDRATEVRNALVDKLCV
FT                   TGMITSLEVERAFRAVPRHLFVPEGTSLEVAYNADDSVAVKRAADGVIISSISAPFIQA
FT                   RMIEQAGLGPGMSVVEIGSSGYNAALLAEIVGPSGRVVSVDIDPEVTDRARALLEATGY
FT                   ADRVTVVRADAQDGVADHGDRVDAILVTAGAWDLSPAWLAQLAEDGRIVVPLRMNGITR
FT                   SIGFRRDGDHLVSTSAEVCGFVPMQGAGAHDERVFLLPDGHGRHVRLRFDANPPQDLDL
FT                   LDGVLATPRSEVWSGVTIRNGVSFADLHLWFACFLSGFCRLAADEGTDLAAERKSWFPF
FT                   GAVQGDSFAYLAVRPALDGAGVEFGGRAYGPHGEAAATALVEQIQAWDRQARGGPAPTF
FT                   AYWPTGADRPPAGEGTAVLAKTHGLVSISWPVAG"
     atgttccgtc tgtggcgccg agagactggg gcaagaccgc cggaaggatc ttcgttgatt        60
     cagatgattg gcacgtccag cgccccggac cgggcgactg aggtccgcaa cgcgctggtc       120
     gacaagctct gcgtgaccgg catgatcacc tcgctggagg tggagcgggc gtttcgtgcc       180
     gtgccgcggc acctgttcgt ccctgagggc acctcgctgg aggttgccta caacgccgat       240
     gactcggtgg cggtcaagcg ggccgcggat ggcgtgatca tctcgtcgat cagcgcgccg       300
     ttcattcagg ctcggatgat cgagcaggcc gggctcggac ccgggatgag cgtggtcgag       360
     atcgggtcca gcggctacaa cgccgcgctc ctcgctgaga tcgtcggccc ctcgggccgg       420
     gtggtcagcg tggacatcga tcctgaggtg accgatcgag cacgcgcgct tctggaagcg       480
     accgggtacg cggaccgggt cacggtcgtt cgcgcggacg cgcaggacgg tgtggccgat       540
     cacggtgacc gggtcgacgc gatcctggtg acggccggcg cctgggatct ctcgccggcg       600
     tggctcgcgc agctggccga ggacggccgg atcgtcgtgc cactgcgaat gaacgggatc       660
     acccggtcga tcgggttccg ccgcgacggc gatcatctgg tgagcacctc ggccgaggtg       720
     tgcgggttcg tccccatgca gggcgccggt gcccacgacg agcgggtctt ccttctgccg       780
     gatgggcacg gccgtcatgt caggctgcgt ttcgacgcca acccgcccca ggacctggat       840
     cttctggacg gtgtcctggc gacacctcgg tccgaggtgt ggtccggggt cacgatccgt       900
     aacggtgtgt cgttcgccga cctgcacctg tggttcgcgt gcttcctgtc tggcttctgc       960
     cggctggcgg cggacgaggg aaccgatctg gctgctgaac gcaagagctg gttccccttc      1020
     ggggctgtgc agggcgactc gttcgcctat ctggcggtgc gcccggcgct ggacggcgcc      1080
     ggtgtcgagt tcggcgggcg agcgtacggc ccgcacggcg aggccgctgc taccgcgctc      1140
     gtcgagcaga tccaggcctg ggatcgccag gcacggggcg gaccggcccc gaccttcgcc      1200
     tactggccga cgggcgccga ccgtccgccg gccggcgagg gcacggccgt gctggcgaag      1260
     acccacggcc tggtctcgat ctcctggccg gtcgctggct ga                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page