(data stored in ACNUC7421 zone)

EMBL: CP000820.PE570

CP000820.PE570       Location/Qualifiers
FT   CDS_pept        672256..673473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0580"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: fal:FRAAL3129 putative formyl-coenzyme A
FT                   transferase (formyl-CoA transferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10039"
FT                   /db_xref="GOA:A8KXD6"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXD6"
FT                   /protein_id="ABW10039.1"
FT                   /translation="MTAVMQGVRILEVAEHTFVPAASALLSDWGADVIKIEHVERGDAM
FT                   RALASSGVAVVPKDVHVLLEHSNRGKRSLGLDLTSQAGRDILYKLAGTCDVFLTNKLPS
FT                   VRTKLHVDVEDIRAHNPNIIYVRGTGQGERGPDADRGSYDSLAFWARAGVAVGSMRPEY
FT                   SHVPVPPAPGFGDSIGAMTIAGGIMGALFHRERTGEATEVDVSLMATGMWAMGQALALS
FT                   LLLDIPWTPPPLDAPRSNPLTGNYQTKDGRWLSFTCLQAGKYWAPMCEAIGRPELGADP
FT                   RFVDHAALMANSREAIAILEAAFAEHPLAEWRERLATFIGQWTVVQDTLEAAADPQAVA
FT                   NGYVQDCATAAGIPFRMAAAPVQYGGKPAPAGRAPLFNEHGDEILTELGLDTDAVLDLK
FT                   IRGVVA"
     atgaccgcgg tgatgcaggg tgtacggatt ctcgaggtcg ctgagcacac gttcgtaccc        60
     gctgcgtccg cgttgctgtc ggactggggc gccgacgtca tcaagatcga gcacgtcgag       120
     cgtggggacg cgatgcgcgc gctggcgtcc tcgggtgtcg cggtcgtccc gaaggacgtc       180
     cacgtgctgt tggagcactc caaccgtggc aagcgcagcc tcggcctcga cctgacctcc       240
     caggccggcc gcgacatcct ctacaagctc gccggcacct gcgatgtgtt cctgacgaac       300
     aagctgccca gcgtgcgtac caagctgcat gttgatgtcg aggacatccg cgcccacaac       360
     ccgaacatca tctacgtccg cgggaccggg cagggcgaac gcgggccgga cgcggaccgt       420
     ggctcctacg actcgctggc cttctgggcc cgcgccggcg tcgcggtcgg cagcatgcgc       480
     ccggagtaca gccatgtccc ggtcccgccc gcgcccggtt tcggtgactc gatcggcgcg       540
     atgacgatcg ccggcgggat catgggcgcg ttgttccacc gcgagcgcac cggtgaggcc       600
     accgaggtcg acgtctccct gatggccacc gggatgtggg cgatgggtca ggccctcgcc       660
     ctgtcgctgc tgctcgacat cccgtggacc ccgccgccgc tggacgcgcc gcgttccaac       720
     ccgctgaccg ggaactacca gaccaaggac ggccgctggc tgtcgttcac ctgcctgcag       780
     gccgggaagt actgggcgcc gatgtgcgag gccatcgggc gtcccgagct cggcgccgac       840
     ccgcgtttcg tcgaccacgc cgcgctgatg gcgaacagcc gggaggccat cgcgatcctc       900
     gaggccgcct tcgccgagca cccgctggcc gagtggcgtg agcggttggc gaccttcatc       960
     ggccagtgga cggtcgtgca ggacaccctg gaggccgccg cggacccgca ggccgtcgcc      1020
     aacgggtacg tccaggactg cgccaccgcc gccggcatcc cgttccggat ggccgccgcc      1080
     ccggtgcagt acggcgggaa gcccgcgccg gcgggccggg cgccgctgtt caacgagcac      1140
     ggcgacgaga tcctcaccga gctcggactc gacaccgacg ccgtcctcga cctcaagatc      1200
     cgcggcgtcg tcgcatga                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page