(data stored in ACNUC7421 zone)

EMBL: CP000820.PE572

CP000820.PE572       Location/Qualifiers
FT   CDS_pept        674429..674881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0582"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: fal:FRAAL2441 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10041"
FT                   /db_xref="GOA:A8KXD8"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXD8"
FT                   /protein_id="ABW10041.1"
FT                   /translation="MKEQRRGRKIAMSRDEIDAFLTEERTCRVATSSPSGPHLTPLWFV
FT                   WDGAALWLNSVVKSQRWTDIARDPRVAVLIDGGHAFNELHGVELRGKLESVGEAPRTGT
FT                   PDPDLETPEKLFAQKYTGRDEMHYDGRHAWLRLTPEKITSWDFRKM"
     atgaaagagc agcgccgggg ccgcaagatc gccatgagcc gggacgagat cgatgcgttc        60
     ctcaccgagg agcgaacctg ccgggtggcg acgtccagcc cgagcggacc acatctgact       120
     ccgctgtggt tcgtgtggga cggcgccgcg ctgtggctca actcggtcgt gaagagccag       180
     cgctggaccg acatcgcccg cgacccgcga gtggccgtgc tcatcgatgg cggccacgcc       240
     ttcaacgagc tacacggggt cgagctccgc gggaagctcg aaagcgtcgg agaagctccc       300
     cggaccggca cccccgaccc ggacctcgaa acaccggaaa agctcttcgc ccagaaatac       360
     accggccgcg acgaaatgca ctacgacggc cgccacgcct ggctgcgcct caccccggag       420
     aaaatcacca gctgggactt ccgaaaaatg tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page