(data stored in ACNUC7421 zone)

EMBL: CP000820.PE576

CP000820.PE576       Location/Qualifiers
FT   CDS_pept        678635..679573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0586"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   rxy:Rxyl_1589 alcohol dehydrogenase GroES-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10045"
FT                   /db_xref="GOA:A8KXE2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXE2"
FT                   /protein_id="ABW10045.1"
FT                   /translation="MKAARPKAGEITVVDLDEPPGVGDEVIRIAAASICSSDLMYMRFG
FT                   LERVIGHELAGVRADGTGAVVEALYGCMECDLCLDGRYNLCPTHIHRALGSSADGGMAE
FT                   QFRVPSQRLVALPPGLDIRDASLVEPASVSWHALRLAGTGPDTRLAVVGAGALGLLAAA
FT                   GARRQGAPEVDLEARHPHQVEAGERLGAKVGTTGLYDVVVEAAGTSASLARAVDLVAPG
FT                   GTVVVVGFHMGTVEVNWSPLFHREARLIPSMSYCRHANGREMEDAAAMLADNPEIARTL
FT                   ITHRFPLEDAVEAFRVAADRKAGALRVVVEP"
     gtgaaggccg cacgccccaa agcgggagag atcaccgtcg tcgacctcga cgagccaccg        60
     ggagtcgggg acgaggtcat ccggatcgcg gcagcgagca tctgcagctc ggacctgatg       120
     tacatgcggt tcgggctgga acgggtcatc ggacatgagc tggccggcgt ccgcgcggac       180
     ggaaccgggg ccgtcgtgga ggcgctctac gggtgcatgg aatgcgacct gtgtctggac       240
     ggccggtaca acctgtgccc cacccacatc catcgggcac tgggctccag cgcggacggc       300
     gggatggccg agcagttccg cgtcccctcg cagcggctcg tcgcgctgcc gcccggtctc       360
     gatatccgcg acgcctcgct cgtcgagccc gcgtcggtct cctggcacgc cctccggctg       420
     gccggcaccg gtccggacac ccggctggct gtcgtggggg ccggtgcact cggcctgctc       480
     gccgccgccg gcgcgcgccg tcagggtgct cccgaggtgg acctcgaggc acgccatccg       540
     caccaggtcg aagccggcga gcgcctcggg gccaaggtcg ggaccacggg cctgtacgac       600
     gtggtcgtgg aggccgcggg aacgtcggcc agcctcgccc gcgccgtcga cctcgtggcg       660
     ccgggcggga cggtggtcgt cgtcggcttc cacatgggca cggtggaagt caactggtct       720
     ccgctgttcc accgtgaggc ccggctcatc ccctcgatga gctactgccg gcacgcgaac       780
     gggcgcgaga tggaggacgc ggcggccatg ctcgccgaca acccggagat cgcccgcacg       840
     ctgatcaccc atcggttccc gcttgaggac gctgtcgagg cgttccgggt agccgccgac       900
     cgcaaggccg gagcgctgcg ggtggtggtc gaaccatga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page