(data stored in ACNUC7421 zone)

EMBL: CP000820.PE577

CP000820.PE577       Location/Qualifiers
FT   CDS_pept        680099..680359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0587"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL5680 molybdenum cofactor biosynthesis
FT                   protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10046"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXE3"
FT                   /protein_id="ABW10046.1"
FT                   /translation="MPACRSWSAGLDRVNVSLDTTSPDRFRAITAPEIPASLRAEFTLT
FT                   PLAGRGSAPAELFEVDGGPGPGPGPGRSARPADVGDRWLSW"
     gtgccagcct gccgaagctg gtcggccggc ctggaccggg tgaacgtctc cctcgacacg        60
     acctcgccgg accggttccg tgcgatcacc gcaccggaga tccctgcctc cctgcgcgcc       120
     gagttcacgc tcacgccgct ggccggccgg ggcagcgcgc cggccgagct gttcgaggtg       180
     gacggtggcc cgggcccggg cccgggcccg ggtcggtcgg cccgaccggc cgatgtcggc       240
     gatcggtggc tgagctggtg a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page