(data stored in ACNUC7421 zone)

EMBL: CP000820.PE581

CP000820.PE581       Location/Qualifiers
FT   CDS_pept        684026..684784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0591"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rxy:Rxyl_3188 transcriptional regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10050"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYF4"
FT                   /protein_id="ABW10050.1"
FT                   /translation="MSLKAGSGGCVRCRVRPGVRVAAQEPGGLVRSKRAKIPALMEPPS
FT                   GTSKVETRLLRDPWPSRKPVIVTRYSTSSTYTRSFSWTFGSWTTSFGCAPWFGVSSSPR
FT                   SLLFRDVARSEAGAATLYAVTDDQPARSTRWREFIAPQGYGDELRAAFRLGGTTWGVVD
FT                   LMRDRSRAPFTPAEVELVRAIAPAVGAALRALATREAAMKLQSPRGRRPRDRAVRRRGH
FT                   VALPRRAGGTAVRRALRPRHPRSRCPGCPR"
     atgtccctca aggccggatc cggtgggtgt gtccgttgtc gggtccgacc gggggtccgt        60
     gtcgcggctc aggagccggg cgggcttgtc cgttcgaagc gcgcgaagat cccggcgctg       120
     atggaaccgc cctcggggac gtcgaaggtg gagactcgcc ttctccgtga cccttggccc       180
     agcaggaaac cggtgatcgt cacccggtac tcgacgtcgt cgacgtacac caggtcgttc       240
     tcgtggacct tcgggagctg gaccacgtcg ttcgggtgcg cgccctggtt cggtgtctcc       300
     tcttctccga ggtcgctgct gttccgggac gtcgcccggt cggaggcggg cgcggccacg       360
     ctgtacgcgg tcaccgacga ccagcccgcg cgcagcaccc ggtggcgcga gttcatcgcc       420
     ccgcagggct acggcgacga gctgcgggcc gccttccgcc tcggtggaac gacctggggt       480
     gtcgtcgacc tgatgcgcga tcgcagccgg gcgccgttca cgcccgcgga ggtcgagctc       540
     gtccgcgcga tcgcaccggc cgtcggagcc gcgttgcggg cgctcgccac ccgcgaggcg       600
     gccatgaagc tccagtcgcc tcgcggacgg cggcccaggg accgcgctgt acgacgacgc       660
     gggcacgttg ctctccctcg acgggcaggc ggaactgctg ttcgccgagc actacggccc       720
     cgtcatccac gctcccgatg ccccggttgc ccacgttga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page