(data stored in ACNUC7421 zone)

EMBL: CP000820.PE582

CP000820.PE582       Location/Qualifiers
FT   CDS_pept        685253..686605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0592"
FT                   /product="condensation domain protein"
FT                   /note="PFAM: condensation domain protein; KEGG:
FT                   fal:FRAAL4708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10051"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYF5"
FT                   /protein_id="ABW10051.1"
FT                   /translation="MLATLRRRVSVQVDVQSQGCSPGPVPDRFLTSSEQILAASDRPDA
FT                   PLTCGFLVQFEGELDAARLRCAVREASRRHPMMRAALYGARQYAWRFGTEPPAGSVGLV
FT                   EDGSSGWDVHEMMVSGRFDLHAHPPLRIALVRGPDGDQLSLVAHHLAVDGMGLTTILSD
FT                   IIAEYRLAEVATVTAGPVDTHVGLPAGVPPAAKAAVAGWTAFTRRSGRHITPMGTGRDT
FT                   GYGYQPLTLPVPGRVLLGSGRRITVNDLLMAATHLTIDRWNRQRGGESGKLRIRMPISL
FT                   GNAAEVGGNNTGQALVVTEPTDRADLARLAARVVDQTERAKQAATAPPIAGVAGKVGMV
FT                   ATELTPGPWRVPLLRWGVRAARPLITPAAAVSNIGSLSSLASDEPKISSVYFTATVGMP
FT                   QGLLICVAGYGNNIHVTFGYHRHLFGREAASAFANLFRTAFGELTRIGSAM"
     gtgctggcta ctttgagaag gcgggtgtca gtgcaggtcg atgtccagag tcagggctgc        60
     tcgccggggc ctgttcccga ccggttcctc acgtcgagcg aacagatcct ggccgcctcc       120
     gatcggccag atgcgccgct gacctgcggt tttctcgtgc agttcgaagg cgagctggat       180
     gcggcgcggc tccggtgtgc cgtgcgtgag gcgagtcgcc ggcatcccat gatgcgggcg       240
     gccctctacg gcgcgcgcca gtatgcgtgg cggttcggca ccgaaccgcc ggcaggctcc       300
     gtcgggctgg tcgaagacgg aagtagcggc tgggacgtcc acgagatgat ggtgtcgggc       360
     cgtttcgacc tgcatgccca tccaccgctg cggatcgcgt tggtccgtgg accggacggc       420
     gaccagcttt ccctcgtcgc gcaccacctc gcggtcgacg gcatgggtct taccacgatt       480
     ttgtccgaca tcatcgccga gtaccggctg gcggaagtgg ccacggtcac cgcggggcct       540
     gtcgacaccc atgtcgggct gcccgccggg gtgccgccgg ccgcgaaggc ggccgtggcc       600
     ggctggaccg ccttcacccg acgctccggc cgacacatca cgcccatggg gaccgggcgg       660
     gacaccggtt acggctatca gccgttgacc ctgccggtgc ccggccgagt gctgctcggc       720
     tccgggcggc gaatcaccgt gaatgatctt ctgatggccg cgacccacct caccatcgac       780
     cggtggaatc gtcaacgcgg cggggaatcc ggaaagctgc gcatcaggat gccgatcagt       840
     ctgggaaacg cggccgaggt gggtggcaac aacaccggtc aggcgttggt ggtcaccgaa       900
     ccgacggacc gggcggatct ggcgaggctg gccgcccgcg tcgtggacca gacggaacgc       960
     gcgaagcagg cggcgaccgc ccctcccatc gcgggtgtgg cgggcaaggt cggtatggtc      1020
     gcgaccgagt tgactcccgg cccatggcga gtcccgttgc tgcggtgggg ggtgcgggcg      1080
     gcgcgcccgc tcatcacgcc cgctgccgcc gtcagtaaca tcggctcgct ttccagcctg      1140
     gcctccgacg agccgaagat atcctcggtc tatttcaccg ctaccgtcgg catgccccag      1200
     gggctgctta tctgcgtggc cggttacggt aacaacatcc acgttacttt cgggtatcac      1260
     cggcacctct tcgggcgcga agccgcctcg gcattcgcga atcttttccg gacggccttc      1320
     ggtgagctga cccgcatcgg gtcggccatg taa                                   1353
//

If you have problems or comments...

PBIL Back to PBIL home page