(data stored in ACNUC7421 zone)

EMBL: CP000820.PE583

CP000820.PE583       Location/Qualifiers
FT   CDS_pept        complement(686811..687362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0593"
FT                   /product="protein of unknown function DUF1003"
FT                   /note="PFAM: protein of unknown function DUF1003; KEGG:
FT                   fal:FRAAL4727 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10052"
FT                   /db_xref="GOA:A8KYF6"
FT                   /db_xref="InterPro:IPR010406"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYF6"
FT                   /protein_id="ABW10052.1"
FT                   /translation="MSTHPDQPAAPRPTASPQPPHPRLRPHPRVRNERALAARARTSQD
FT                   RVSDAITAFAGSMPFVYLHAAWFTIWILLNKGAFGDAAVFDPYPFGLLTMIVSLEAIFL
FT                   STFVMISQNRQAAREDIRADLDFETNLRSEVWSVHIGKALGLDAEAIERHATEVITESK
FT                   AMISRGETSSRQVTPPAQSQ"
     gtgagcaccc atcctgacca gcccgcagct ccccggccca cggcttcccc gcagccgccg        60
     catcctcggc tgcgcccaca tccccgggtc cgcaacgagc gggccctggc cgctcgggcg       120
     cggacgtccc aggacagggt ctcggacgcg atcacggcat tcgccgggtc aatgcccttc       180
     gtctacctgc acgccgcgtg gttcacgatc tggatcctcc tgaacaaggg ggcgttcggg       240
     gacgcggccg tcttcgaccc ctacccgttc ggcctgctca cgatgatcgt cagcctcgaa       300
     gcgatcttcc tgtcgacgtt cgtgatgatc agccagaacc ggcaggccgc gagggaggac       360
     atccgggctg atctcgactt cgagaccaat ctccgctccg aggtgtggtc ggtgcacatc       420
     ggcaaggcgc ttgggctgga cgcggaggcc atcgagcggc acgccacgga ggtcatcact       480
     gaaagcaagg ccatgatcag ccgcggggag acgtcctcgc gtcaggtaac acccccggca       540
     cagagtcagt ag                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page