(data stored in ACNUC7421 zone)

EMBL: CP000820.PE586

CP000820.PE586       Location/Qualifiers
FT   CDS_pept        complement(689068..689679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0596"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mav:MAV_0966
FT                   transcriptional regulator, TetR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10055"
FT                   /db_xref="GOA:A8KYF9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYF9"
FT                   /protein_id="ABW10055.1"
FT                   /translation="MVSQRQAGSATSSTRDQLLDAAEQLMLEEGYAAVTSRRVGARAGL
FT                   TPQLVHYYFRTMDDLFLEVFRRRADVGLELFRAALQSRPTLRQLWDLRDTGMTTPRFNL
FT                   EFMALANHRKAIRVVLTEYYRSYREVQLAAFTAALADLGVPPERCPPLVARLVMIGITQ
FT                   IMAIDAELGVESDSEVVDDFIRRQIEDLVEQGPERTDSDT"
     atggtcagcc aacgccaagc tggttcggct acgtcgagca cccgcgacca gctgctcgac        60
     gcggcggagc aactgatgct ggaggagggc tacgccgcgg tcacctcacg tcgcgtcggc       120
     gcccgggctg ggctcacacc ccagctggtg cactattact tccgcacaat ggacgatctt       180
     tttctggagg tcttccgccg ccgcgcggac gtcggcctgg agctcttccg agctgcgctc       240
     cagagccggc ccacgctgcg gcagctgtgg gacctacgcg acacgggcat gacgacgccc       300
     aggttcaatc tcgagttcat ggcgctggcc aaccaccgca aggcgatccg ggtagtccta       360
     accgagtact accggagcta ccgcgaggta cagctcgcgg cattcacggc cgccctggcg       420
     gacctcggtg tcccgccgga gcgttgcccg ccgttggtgg cccgactggt catgatcggc       480
     atcacccaga tcatggcgat cgacgcggag ctgggcgtcg agtccgacag cgaagttgtc       540
     gacgatttca tcagacgaca gatcgaagac ctggtcgagc aagggccgga gcggaccgac       600
     agcgacacat ag                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page