(data stored in ACNUC7421 zone)

EMBL: CP000820.PE591

CP000820.PE591       Location/Qualifiers
FT   CDS_pept        697782..700046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0601"
FT                   /product="K+-transporting ATPase, B subunit"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; K+-transporting ATPase, B
FT                   subunit; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; E1-E2 ATPase-associated domain protein; KEGG:
FT                   fal:FRAAL5301 P-type ATPase, high-affinity potassium
FT                   transport system, B chain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10060"
FT                   /db_xref="GOA:A8KYG4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYG4"
FT                   /protein_id="ABW10060.1"
FT                   /translation="MSTTTIAAHQDGASAAGRRETQPARPRRVGGGLLDPKQLWTSLPS
FT                   AVRKLDPRTLWHNPVMLIVEVGAAYTTVLAIIDPSAFGWMITVWLWLTVIFANLAEAVA
FT                   EGRGKAQAAALRRARTETVARRLVGWRAGQPVESAAVESVPAPRLAQHDLVVVEAGELI
FT                   PGDGDIVEGIASVDESAITGESAPVIRESGGDRSSVTGGTRVLSDRIVVRITQKPGESF
FT                   IDRMIALVEGANRRKTPNEIALNILLAALTVIFLLAVATLQPLAIYSKAQQPALPDSST
FT                   LTGDGITGIVLASLLVCLIPTTIGALLSAIGIAGMDRLVQRNVLAMSGRAVEAAGDVNT
FT                   LLLDKTGTITLGNRQASAFLAVGGVSEAELADAAQLSSLADETPEGRSVVVFAKEHHGL
FT                   RERTPGELAHATFVHFTAQTRMSGVDLAPEPTGPGAPGAPGTSSAVGARRVRKGAASAV
FT                   TRWVRENGGQVPAQVGEIVDGISASGGTPLVVGEVIDGPSGPSGPSGPAARVLGVIQLK
FT                   DVVKSGMRERFDAMRRMGIRTVMITGDNPLTAKAIADEAGVDDFLAEATPEDKLALIRR
FT                   EQAGGKLVAMTGDGTNDAPALAQADVGVAMNTGTSAAKEAGNMVDLDSNPTKLIEIVEI
FT                   GKQLLITRGALTTFSIANDVAKYFAIIPAMFAGVYTGLDRLNVMRLASPESAILSAVIF
FT                   NALVIVALIPLALRGVRYTPASASKLLSRNLYVYGLGGIVVPFAGIKVIDLLVQFIPGV
FT                   G"
     atgagtacca ccaccatcgc cgcgcaccag gacggcgcca gcgccgccgg ccggcgggaa        60
     acgcagccgg cccgaccgcg gcgggtcggg ggcggtctgc tcgacccgaa gcagctttgg       120
     acgtccctgc ccagcgcggt gcgcaagctc gacccgcgga ccctgtggca caacccggtc       180
     atgctgatcg tcgaggtcgg cgccgcgtac accaccgttc tcgcgatcat cgacccgtcg       240
     gcgttcggct ggatgatcac ggtctggctg tggctcaccg tgatcttcgc caacctcgcc       300
     gaggccgtcg cggaggggcg cggcaaggcg caggccgccg ccctgcgccg ggccaggacc       360
     gagaccgtcg cccgccggct cgtcggctgg cgcgcgggcc agcccgtcga gagcgccgcg       420
     gtcgagagcg tgccggcgcc gcggctcgcc cagcacgacc tggtcgtggt cgaggcgggg       480
     gagctcatcc ccggggacgg tgacatcgtc gagggcatcg ccagcgtgga tgagtcggcg       540
     atcacgggcg agtcggcgcc ggtgatccgg gagtccggtg gtgaccggtc ctcggtcacc       600
     ggcgggacga gggtgctctc cgaccggatc gtcgtccgga tcacccagaa gcccggggag       660
     agcttcatcg atcggatgat cgccctggtc gagggcgcga accggcgtaa gacgccgaac       720
     gagatcgcgc tcaacatcct gctggccgcg ttgaccgtca tcttcctgct ggccgtcgcc       780
     acgctgcagc cgctggcgat ctactcgaag gcccagcagc cggcgctgcc ggacagctcc       840
     accctgaccg gtgacgggat caccgggatc gtgctcgcgt ccctgctggt ctgcctgatc       900
     ccgaccacga tcggagcgct gctttccgcg atcggcatcg ccgggatgga ccggctcgtc       960
     cagcgcaacg tgctcgcgat gagcggccgg gcggtggagg ccgccggcga cgtcaacacg      1020
     ctcctgctcg acaagaccgg caccataacc ctggggaacc ggcaggccag cgcgttcctc      1080
     gccgtcggcg gcgtgagcga ggcggagctg gcggacgccg cccagctctc ctcgctcgcc      1140
     gacgagaccc ccgagggccg ctcggtcgtc gtgttcgcca aggagcacca cggcctgcgc      1200
     gaacgcaccc cgggcgagct ggcgcacgcg acgttcgtgc acttcaccgc ccagaccagg      1260
     atgtccggcg tcgacctggc gcccgagccc accggcccgg gcgcgcccgg cgcccccggg      1320
     acgtccagcg ccgtcggcgc ccggcgggtt cgcaaggggg cggcaagcgc ggtcacccgg      1380
     tgggtgcggg agaacggggg gcaggtaccc gcccaggtcg gggagatcgt ggacggtatc      1440
     tccgcctcgg gcggtacccc gctggtcgta ggcgaggtca tcgacggccc gtccggcccg      1500
     tccggcccgt ccggcccggc cgcgcgggtg ctcggcgtca tccagctcaa ggacgtcgtg      1560
     aaatccggca tgcgggagcg cttcgacgcc atgcgccgga tgggtatccg caccgtgatg      1620
     atcaccgggg acaacccgct caccgcgaag gcgatcgccg acgaggcggg tgtcgacgac      1680
     ttcctcgccg aggcgactcc ggaggacaag ctcgcgctga tccgcaggga gcaggcgggc      1740
     ggcaagctcg tcgcgatgac cggcgacggc accaacgacg cgcccgcgct cgcgcaggcc      1800
     gacgtcgggg tggccatgaa caccggcacg tcggccgcga aggaggccgg caacatggtc      1860
     gacctcgaca gcaacccgac gaagctcatc gagatcgtcg agatcggcaa gcagctgctc      1920
     atcacccgcg gggcgctgac gaccttctcc atcgccaacg acgtcgccaa gtacttcgcg      1980
     atcatcccgg cgatgttcgc cggcgtctac accggcctgg acaggctcaa tgtcatgcgg      2040
     ctggccagcc ccgagtcggc gatcctctcc gcggtcatct tcaacgccct cgtcatcgtc      2100
     gcgctgatcc cgctcgcgct gcgcggtgtg cgctacaccc ccgccagcgc gtcgaagctg      2160
     ctcagccgca acctctacgt ctacggcctc ggtgggatcg tcgtcccgtt cgccggcatc      2220
     aaggtcatcg atcttctcgt ccagttcatc ccgggagtgg gctga                      2265
//

If you have problems or comments...

PBIL Back to PBIL home page