(data stored in ACNUC7421 zone)

EMBL: CP000820.PE600

CP000820.PE600       Location/Qualifiers
FT   CDS_pept        708972..709787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0610"
FT                   /product="Survival protein SurE"
FT                   /note="PFAM: Survival protein SurE; KEGG: mem:Memar_1385
FT                   stationary-phase survival protein SurE"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10069"
FT                   /db_xref="GOA:A8KYH3"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYH3"
FT                   /protein_id="ABW10069.1"
FT                   /translation="MKRRVQSTGGRSGDSGRRRGDLVGQVGRSDRRRRTARASAALLAA
FT                   VAVVLTAAGCGGGGKTTMPTPTHRDAATAGGITATAVDGFPADAVTVALDVLRLTPDLV
FT                   VSGINQGQNLGPVVDLSGTVGAARAAASRGVPAIASSMGTGDAFDFAPAVKLVTDWVTA
FT                   HRAELSAGAPSSGPRATIANLNIPNCAAGGRIRGERELPTQPALPDLAVALAPQDCTSS
FT                   AEPGEEVAAFTAGFATLTEIPASPASPASPDTPAAVVTAAPAGPSPAAK"
     atgaagaggc gcgtgcagtc cacgggcggc aggtccgggg actccggacg gcgcagggga        60
     gatctcgtgg ggcaagtggg acgttcggat cgccgtcggc ggactgctcg ggcgtcggcc       120
     gcgctcctcg ccgcggtcgc cgtggttctc acggcggccg gctgcggtgg cggtgggaag       180
     acgaccatgc ccaccccgac gcaccgcgac gcggccaccg ccggcgggat cacggcgacc       240
     gccgtcgacg gcttcccggc ggacgccgtc acggtggcgc tggacgtcct gcggctcacc       300
     ccggacctgg tcgtctccgg catcaaccag ggccagaacc tgggtccggt ggtcgacctc       360
     tccggcaccg tcggcgcggc cagggcggcc gcgtcccgcg gggtcccggc gatcgcgtcg       420
     agcatgggga cgggtgacgc cttcgacttc gcccccgccg tcaagctggt caccgactgg       480
     gtgaccgcgc accgggcgga gctgtcggcc ggcgcgccct cgagcggccc gcgggccacc       540
     atcgccaacc tgaacatccc gaactgcgcg gccggcggac gcatccgcgg tgagcgtgag       600
     ctgccgaccc agccggcgct gccggacctg gccgtcgcgc tggccccgca ggactgcacg       660
     tcgagcgcag agccgggcga ggaggtcgcc gcgttcacgg cgggcttcgc gacgctcacc       720
     gagatcccgg ccagcccggc cagcccggcc agcccggaca ccccggccgc ggtcgtgacc       780
     gcggccccgg cggggccgtc gcccgccgcg aagtag                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page