(data stored in ACNUC7421 zone)

EMBL: CP000820.PE609

CP000820.PE609       Location/Qualifiers
FT   CDS_pept        720249..721457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0619"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: mpa:MAP2185c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10078"
FT                   /db_xref="GOA:A8KYI2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYI2"
FT                   /protein_id="ABW10078.1"
FT                   /translation="MTSSQSLDWLISVDDHVLEPPNLWTDRLPAKDHDRAPHMVIDDTG
FT                   MDCWVYDGKRFPSSGLSAVAGKEKEEFSPEPLSYADMRPGCYDPQARLEDMNRAGILAS
FT                   LCFPTVTRFCGQMFSEASDREFGLVCLKIYNDWMIEEWCGSAPGRYIPLTLIPLWDPQL
FT                   AVKELERCAAKGSTTFAFSENPAPLGLPTIHDRDGYWEPVMAAANDLEMVASMHVGSSS
FT                   QVPKIAPDAPFMANLTWGAMRTSGAMLSWLFSGMFQRYPKLKIALSEGEIGWMPYYLER
FT                   AEQVIDKQRHWVKRGVRFNEHAGADALDLDTLDIRASFREHVFGCFIDDAHGIASIDEI
FT                   GEDNIMCETDYPHSDSTWPNCIDVVRNRIGHLSEEVQYKILRGNAERLYRFTPAEPPVL
FT                   AKA"
     atgacgtcat cacagtcgct ggactggctg atctcggtcg acgaccacgt cctggagccg        60
     ccgaacctgt ggaccgaccg gctcccggcc aaggaccacg accgggctcc ccacatggtg       120
     atcgacgaca cgggaatgga ctgctgggtc tacgacggca agcgtttccc gagctccggg       180
     ctgagcgccg tcgccgggaa ggagaaggag gagttcagcc ccgagcccct ctcctatgcc       240
     gacatgcggc ccggttgcta cgacccgcag gcccgcctgg aggacatgaa ccgggccggc       300
     atcctggcct cgctgtgctt cccgacggtg acccggttct gcgggcagat gttctccgag       360
     gcgagcgacc gcgagttcgg cctggtgtgc ctgaagatct acaacgactg gatgatcgag       420
     gagtggtgcg gcagcgctcc cggccgctac atcccgctca ccctcatccc gctgtgggac       480
     ccgcagctcg cggtgaagga gctcgagcgc tgcgcggcga aggggtccac caccttcgcc       540
     ttctcggaga acccggcccc gctgggcctg ccgaccatcc acgaccgcga cgggtactgg       600
     gagccggtga tggctgccgc gaacgacctg gagatggtcg cgtcgatgca cgtcggctcc       660
     tcgtcgcagg tgccgaagat cgctcccgac gcgccgttca tggcgaacct gacctggggc       720
     gcgatgcgta cctcgggcgc catgctctcc tggctgttca gcgggatgtt ccagcggtac       780
     ccgaagctga agatcgcgct ctcggagggc gagatcggct ggatgccgta ctacctggag       840
     cgcgccgagc aggtgatcga caagcagcgc cactgggtca agcgtggtgt ccgcttcaac       900
     gagcacgccg gggcggacgc cctcgacctg gacaccctcg acatccgcgc cagcttccgt       960
     gagcacgtct tcggttgctt catcgacgac gcgcacggca tcgccagcat cgacgagatc      1020
     ggcgaggaca acatcatgtg cgagacggac tacccgcact ccgactcgac ctggccgaac      1080
     tgcatcgacg tcgtcaggaa ccggatcggc cacctgtcgg aggaggtcca gtacaagatc      1140
     ctgcgcggca acgccgagcg gctgtaccgg ttcaccccgg ccgagccgcc tgtgctcgcg      1200
     aaggcctga                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page