(data stored in ACNUC7421 zone)

EMBL: CP000820.PE610

CP000820.PE610       Location/Qualifiers
FT   CDS_pept        721459..721710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0620"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_1427 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10079"
FT                   /db_xref="GOA:A8KYI3"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYI3"
FT                   /protein_id="ABW10079.1"
FT                   /translation="MAGRAPLAVVDRERCIGSGMCVDYAPGTFTQDEQAKAVVLAEADD
FT                   PADVVGIAVESCPTGALRLAHDAGLAQNTGLAQDGTGA"
     atggcagggc gggcaccgct cgcggtcgtc gaccgcgagc ggtgcatcgg cagcggcatg        60
     tgtgtggact acgcgccggg caccttcacc caggacgagc aggccaaggc ggtcgtcctc       120
     gccgaggccg acgacccggc cgacgtggtg ggcatcgccg tcgagtcgtg cccgaccggc       180
     gcgctgcgcc tggcgcacga cgcgggcctg gcgcagaaca caggcctggc gcaggacgga       240
     acaggagcgt ga                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page