(data stored in ACNUC7421 zone)

EMBL: CP000820.PE612

CP000820.PE612       Location/Qualifiers
FT   CDS_pept        722500..723747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0622"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mpa:MAP2183c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10081"
FT                   /db_xref="GOA:A8KYI5"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYI5"
FT                   /protein_id="ABW10081.1"
FT                   /translation="MSTTATLDRERVRQLFDLRSSYNVHMGGGYRQDPYPVWHRLREQA
FT                   PVHPGIVHELTGFDGPAMFSGLPYPDRPHFSAFSYAACDAAYRDPEVFASAAGPVDPNN
FT                   GPYGATNSMLSMGGRQHRRYRGLVQPSFVPGKAKWWISNWIEETVDLLIDGFVDAGRAE
FT                   LNVDFCAAIPVLTITSSFGVPVDRALDIRAALTRPDEIVRMLEPIVAARRADPQDDLIS
FT                   ILVQAEMTDENGVTHRLTDAEIYSFSVLLLTAGSGTTWKQMGITLTALLQHPEALAAVR
FT                   ADRSLLRLAIEESLRWSPTDPMFSRWVTEDVDFFGVHMPAGSVLHLCIGAANRDPARWD
FT                   RPDEYDITRALRPSFAFGGGAHVCLGMHVARAEMRVGIGALLDRLPDLRLDPDREAPRF
FT                   IGMYERGATEIPVVFG"
     atgagcacca ccgccaccct cgaccgcgaa cgggtccggc agctgttcga cctgcgcagc        60
     agctacaacg tgcacatggg cggcggctac cggcaggacc cgtacccggt ctggcaccgg       120
     ctgcgcgagc aggccccggt gcacccgggg atcgtccacg agctgaccgg cttcgacggc       180
     ccggcgatgt tctccggtct gccgtacccc gaccgcccgc acttctcggc cttcagctac       240
     gccgcgtgcg acgccgccta ccgcgatccc gaggtgttcg cgtcggcggc cgggccggtg       300
     gatcccaaca acggcccgta cggcgcgacg aacagcatgc tgtcgatggg cgggaggcag       360
     caccgccggt accgcgggct cgtacagccc tcgttcgtgc cgggcaaggc gaaatggtgg       420
     atcagcaact ggatcgagga gaccgtcgac ctgctcatcg acgggttcgt cgacgcgggg       480
     cgggccgagc tgaacgtgga cttctgcgcg gccatcccgg tgctcacgat caccagcagc       540
     ttcggcgtgc ccgtcgaccg ggcgctcgac atccgtgccg cgctgaccag gcccgacgag       600
     atcgtgcgga tgctcgagcc gatcgtcgcc gcccggcgtg cggacccgca ggacgacctg       660
     atcagcatcc tcgtgcaggc cgagatgacc gacgagaacg gggtcaccca ccggctcacc       720
     gacgccgaga tctactcctt ctcggtgctg ctgctgaccg ccggctccgg caccacctgg       780
     aagcagatgg gcatcacgct caccgcgctg ctgcagcacc ccgaggcgct ggccgcggta       840
     cgcgccgacc gctcgctgct ccggctggcg atcgaggagt cgctgcggtg gtcacccacc       900
     gacccgatgt tctcccgctg ggtgaccgag gacgtcgact tcttcggcgt gcacatgccg       960
     gccgggtcgg tgctgcacct gtgcatcggc gcggccaacc gcgacccggc ccgctgggac      1020
     cgcccggacg agtacgacat cacccgcgcc ctgcggccgt ccttcgcctt cggcgggggc      1080
     gcccacgtct gcctgggcat gcacgtggcc cgcgccgaga tgcgggtcgg gatcggggcg      1140
     ctgctcgacc ggctccccga cctgcgcctc gaccccgacc gcgaggcacc ccgcttcatc      1200
     ggcatgtacg agcgaggcgc gaccgagatc cccgtcgtct tcgggtga                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page