(data stored in ACNUC7421 zone)

EMBL: CP000820.PE72

CP000820.PE72        Location/Qualifiers
FT   CDS_pept        91442..92632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0074"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   fal:FRAAL5337 putative ring hydroxylating dioxygenase
FT                   alpha-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09541"
FT                   /db_xref="GOA:A8LB80"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB80"
FT                   /protein_id="ABW09541.1"
FT                   /translation="MDRSELMDLTRRALKVATDRTTDMEPAERRQPADAYTSQESFERE
FT                   RELVLRSPQLVGYRSELPTAGSFCTKTVMDVPVLLTRSQDGTVRAFHNICAHRQAPVAV
FT                   RCGTAERFVCPYHAWTYDTQGRFVGGPGREGFPSLTAGGSGLTELPAAEHAGFLWVGLQ
FT                   PENGPLDIEAHLGPLGPELASWGIGDWSLVGERVLDSPINWKLALDTFAESYHFSTLHR
FT                   GTFAQLALGNCALFDSFGPHHRLVVPLRHITRLTDLPAEEWKPLDNLSIAYALFPNIVV
FT                   SVSAANSEVFRIYPGSGPGHSVTCHQNASGLDLEDETTRAGAERLFDFAHSTVRDEDYQ
FT                   LAVEIQKNLSSGARSELVFGRNEPGLQHRHFVLDARMGRQPRPAGQPGRVDIVHRS"
     atggaccgca gcgagctcat ggacctcacc cggcgcgcgc tcaaagtcgc cacggaccgg        60
     acaaccgaca tggagccggc tgaacgccgt cagccggccg atgcctacac cagccaggaa       120
     agtttcgaac gcgaacgcga actcgtcctc cgctcgccac agctggtcgg ctaccgctcg       180
     gagctgccga ccgccggaag tttctgcacg aagacggtga tggacgttcc cgtactcctg       240
     acccggagcc aggacggcac cgtcagggcc ttccacaaca tctgcgctca tcgccaggca       300
     ccggtcgcgg tgcgctgcgg cacagccgaa cggttcgtgt gcccgtacca cgcctggacg       360
     tacgacacac agggccgctt cgtcggagga cccggccgtg agggtttccc gtcgctgacg       420
     gctggcggaa gcggcctcac ggaactgccg gccgcggagc atgccgggtt tctgtgggtc       480
     ggcctccagc cggagaacgg gcccctggac atcgaggccc atctggggcc gctcggcccg       540
     gagcttgcct cgtgggggat cggcgactgg tcgctggtgg gcgagcgggt actcgactct       600
     ccgatcaact ggaagctcgc tctggacacc ttcgccgaga gctatcactt ctccaccctg       660
     caccgcggca cgttcgccca gctcgccctg ggaaactgcg cgcttttcga ctcgttcggc       720
     ccgcaccatc ggctggtcgt tccgttgcgg cacatcacgc gcctcacgga ccttcccgcc       780
     gaagagtgga agccgctgga caacctgtcg atcgcttatg cgctgtttcc taacatcgtc       840
     gtctcggtga gtgccgccaa cagcgaggtc ttccggatct accccggcag cgggcccggg       900
     cactcggtga cctgccacca gaacgcctcc gggctggacc tcgaagacga gaccacccgg       960
     gcgggtgcgg agagactgtt cgacttcgcg cactcgacag tccgcgacga ggactatcag      1020
     ctcgctgtcg agatccagaa gaacctttcc tcgggcgcgc gatccgaact ggtcttcggg      1080
     cgcaacgagc cgggtcttca gcaccgtcac ttcgtcctcg acgcaaggat gggccgtcag      1140
     ccgcggccag ccgggcagcc agggcgagtg gacattgttc atcgttcatg a               1191
//

If you have problems or comments...

PBIL Back to PBIL home page