(data stored in ACNUC7421 zone)

EMBL: CP000820.PE76

CP000820.PE76        Location/Qualifiers
FT   CDS_pept        complement(95113..95979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0078"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: tth:TTC1745 corticosteroid 11-beta-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09545"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB84"
FT                   /protein_id="ABW09545.1"
FT                   /translation="MTETERRGGVLVSGAAGGIGAATVRLLADRGYLVFAAVRAENHTS
FT                   RVLADLSGVQVVTMDVADPESVATAAEEVNGAVPNGGLRAVVNNAGVIVQGPLELVPPD
FT                   ELRRQFEVNTFGPAYVTQAFLPMLRAGHGRIINVTAPTARVPMPFMAPISASKAALDAL
FT                   STALRLELAAWKVPVVLVEPGATETQIFDKADTAAREALGAATPAQVALYRDHLTAMEQ
FT                   ARKRLRTRPVEPVARAIATAVTARRPRRRYSIADARAIGVLAHLPARLRERLVMSTLGL
FT                   RGVGTER"
     atgacggaga cggagcgacg tggcggcgtc ctcgtaagcg gcgcggccgg cgggatcggc        60
     gcggcgaccg tgcggctgct ggccgatcgg ggctacctgg tgttcgcggc ggtgcgcgcg       120
     gagaaccaca ccagccgcgt cctggccgac ctatccggcg tgcaggtggt cacgatggac       180
     gtcgccgacc cggagagcgt cgccacagcg gccgaagagg ttaacggcgc ggtgccgaac       240
     ggcggcctgc gcgcggtggt caacaacgcc ggcgtgatcg tgcaggggcc gctggagctg       300
     gtgccaccgg acgagctgcg ccgccagttc gaggtcaaca ccttcgggcc ggcctacgtc       360
     acccaggcgt ttctgccgat gctgcgggcc ggccacggcc ggatcatcaa tgtcaccgcg       420
     cccaccgctc gcgtcccgat gccgttcatg gcaccgatct cagcgagcaa agcagccctc       480
     gacgcgcttt ccaccgctct gaggctggaa ctggccgcgt ggaaggtgcc agtagtgctc       540
     gtcgagccgg gtgccaccga gacccagatc ttcgacaagg ccgacaccgc agcgcgggag       600
     gcgttggggg cggccacacc ggcgcaggtg gcgctctacc gcgaccacct caccgcgatg       660
     gagcaggcga gaaagcggtt gcggacccgg ccggtcgagc cggttgcccg cgcgatcgcg       720
     accgccgtga ccgcccgccg tccgcggcgg cgttactcca tcgccgacgc ccgcgccatc       780
     ggtgtcctcg cccacctgcc cgcccggcta cgcgagcgcc tggtcatgag caccctcggg       840
     ctacgcgggg tgggaaccga acgatga                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page