(data stored in ACNUC7421 zone)

EMBL: CP000820.PE78

CP000820.PE78        Location/Qualifiers
FT   CDS_pept        complement(97102..97470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0080"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL1739 putative integrase (partial)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09547"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB86"
FT                   /protein_id="ABW09547.1"
FT                   /translation="MRGATGPASTAVHGRAQTVARRGPHRDLMQARCMSSDLCNGRTAR
FT                   FESSSRRPGDHAGRCRFPSLALGALHRQRSRQAKERIDAGEHWWENGLVFASTVGTLME
FT                   PRNVTRRVEQLRDRAGLP"
     gtgcggggtg cgacgggccc ggcgagcacg gccgtccacg gccgcgcgca gacggtcgcg        60
     cggcgcggcc cgcaccgcga cctgatgcag gcacgctgca tgtccagcga tctgtgcaac       120
     gggagaacgg cacgcttcga atcgtccagc cgaagacccg gggatcacgc cggccgctgc       180
     cggtttccct ctctcgcgct cggcgcactg catcgacagc ggagcaggca ggcgaaggag       240
     cggatcgacg ccggcgagca ctggtgggag aacggactcg tcttcgcgtc gaccgtcggc       300
     acgctgatgg agccgaggaa cgtcacgcgg cgcgtcgagc agctccgcga ccgggcgggc       360
     ctcccgtga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page