(data stored in ACNUC7421 zone)

EMBL: CP000820.PE8

CP000820.PE8         Location/Qualifiers
FT   CDS_pept        12333..14270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0008"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL0011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09477"
FT                   /db_xref="GOA:A8LB23"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB23"
FT                   /protein_id="ABW09477.1"
FT                   /translation="MSDSQNDRPARSAVHRASPARPEQRTAAVAGGAPVGGTAAGRAAA
FT                   GGTAAGGASVAGSSRSGTAKAGPVGAAPGVGSGAGSGTGIGKGVPGTTGSGTGVSSAAG
FT                   GGVGGPRSTPGKDDGESKRAFLPGTGRPADGRPGTDGRPADGRSGEGRPAAGGGAGSGS
FT                   RGPSRPSSGSASPGKGAPGSASPGTSGSASPARGAGASGAGAGGAASPFFQRPGRDEND
FT                   PSDRDGAGGQTSQTTRLGVGGTAEPKLLSASATVPGSSSAGTGGGTDRAAPAPRGGDSD
FT                   PDETSRQPAGRQPARDADAARPAGDGRKPTEATRGAGAGTSKDAAPAAGKGASRTGTRA
FT                   DAARPDAARPDTSRAETTRKPDAQTTVRSPAARPGTPVDPPRDSDTISLVRPNLPKRGS
FT                   KPPADRVGADVKTSPDRGAVTDRMPAERRPTPEPVRAATPSTRQAPLAGRTAPYDRPGT
FT                   PPGPLPTSGGVGPNGLSTEPFDRVDDADHGRPGGAPGPQGGPPRGQQQPGGREPGRDTA
FT                   GQGPRRGPAGGRRARLRVSRVEPLSVTRLSFAFSLCVFLIMIVAVAVLWFVLNSIGVFD
FT                   SVTKAADTLTDGTNANVSGWLSFGRAMQVTLLVGAINVVLMTALATLGALLYNLCADMI
FT                   GGLEVTLSDQ"
     gtgagcgaca gtcagaatga ccggcccgcc cggtcggccg tccaccgcgc atccccggcc        60
     cgtccggagc agcgcaccgc ggccgtggcc ggtggcgcgc ctgtcggtgg taccgccgcc       120
     gggcgcgccg cggctggcgg tactgccgcc ggcggtgcct ctgtggctgg ttccagccgg       180
     tccggcacgg cgaaggccgg gcccgtgggc gcggcaccag gcgtgggttc cggtgccggt       240
     tccggaactg ggatcggcaa gggagttccc gggacaaccg gctccggaac cggcgtgagc       300
     tcggcggcgg ggggcggtgt gggtggcccc cgctcgacac cggggaagga cgacggagag       360
     tccaagcgtg cgttcctccc cggcaccggc cgtcccgccg acgggcgtcc cgggaccgat       420
     ggccgtcccg ctgacggccg ctcgggggag ggccgtccgg ccgcgggggg cggggctgga       480
     tcgggttcac gtggtccgtc ccggccctcc tccggatcgg cgtcgcccgg aaagggtgcc       540
     cccggatcgg cgtcgcccgg cacctccgga tcggcgtcgc ccgcgcgtgg cgcgggcgca       600
     agcggtgcgg gcgcgggcgg ggcggcgagc ccgttcttcc agcgtcccgg gcgggacgag       660
     aacgacccgt ccgaccggga cggtgcgggt ggccagacca gtcagacgac acgcctcggc       720
     gtcggcggga cggcagagcc caagctgctg agcgcctcgg cgaccgttcc gggctcgtcc       780
     tcggcgggca ccggcggcgg gacggaccgc gccgcccccg cgccgcgcgg cggtgactcc       840
     gaccccgacg agacatcacg ccagccagcc ggccggcagc ccgcccgcga cgcggacgcg       900
     gccaggccgg cgggcgacgg caggaagccg accgaggcga cccgcggggc cggcgcgggc       960
     acctccaagg acgccgcccc ggcggctggc aagggggcat cccgaacggg cacgcgagcg      1020
     gacgccgccc gaccggacgc cgctcgcccg gatacatcca gagccgagac gacgagaaag      1080
     cccgatgcgc agaccaccgt cagaagcccg gcggcacgcc ccggcacacc ggtcgaccca      1140
     ccccgggaca gcgacacgat ctcgctggtg cgaccgaacc tgcccaagcg gggctcgaag      1200
     cccccggcgg atcgcgtcgg cgcggacgtg aagacctccc cggatcgcgg cgcggtcacc      1260
     gaccgcatgc ccgccgagcg ccgccccacc cctgaaccgg tgcgggcagc cactccgtcg      1320
     acccggcagg cgccgctggc gggccgcaca gccccctacg atcgccctgg gacgccgcca      1380
     gggccactgc cgacgtccgg aggtgtgggc ccgaacggtc tgtccaccga gccgttcgac      1440
     cgggtcgacg acgccgacca cggccggccc ggcggtgctc ctggaccaca gggtggtccc      1500
     ccgcgggggc agcagcagcc gggcggccgt gagccggggc gggacaccgc cggccagggc      1560
     ccacgccggg gccccgccgg tggccggcgt gcccgcctgc gggtctccag ggtggaaccg      1620
     ctctcggtga ccaggctctc gttcgcgttc tcgctgtgcg tcttcctgat catgattgtc      1680
     gccgtggcgg tgctgtggtt cgtgctgaac tcgatcgggg tcttcgacag cgtcaccaag      1740
     gccgctgaca ccctgaccga cggcacgaac gccaatgtct caggctggct gtccttcggg      1800
     cgggcgatgc aggtcaccct gctggtcggg gcgatcaacg tcgtcctgat gacggcgctg      1860
     gcgaccctgg gcgcactgct ctacaacctc tgcgcggaca tgatcggcgg gctcgaggtc      1920
     accttgagtg accagtag                                                    1938
//

If you have problems or comments...

PBIL Back to PBIL home page