(data stored in ACNUC7421 zone)

EMBL: CP000820.PE82

CP000820.PE82        Location/Qualifiers
FT   CDS_pept        100328..101554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0084"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   bad:BAD_0485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09551"
FT                   /db_xref="GOA:A8LB90"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB90"
FT                   /protein_id="ABW09551.1"
FT                   /translation="MTGAGAGTDETRTGETRTGETSVTAPPTAAEYKAGGRCVPSRAWA
FT                   RAMTASWASPLRRRPRRHLLVLAGAGAAALIVAAALGFGGSPPPSPTGPVPAATATVQR
FT                   GTLTQTQQVGGLISYGEPVGLVAQQQSGVLTWVAAPGTTVKIGQPVYAVDGRPVVLLHG
FT                   TATPYRTLATGTVGSDVKELEASLQELGYTGFAVDDTFDAATASAVQAWQAKSGLPAQG
FT                   TVSPDQIFVHDGDIRVALQAIPVGSHLGLQPNQQVLTYSGTTQVASIPLDVSLQHLVHT
FT                   DDPATIALPTGQRLDGTVSSVGTVAQTIEEQNKTFVTVIVSFGDPSALAGGFDSSPVTL
FT                   TIVTGQRANVLTVPVTALVANPDGGYAVQTVQNGQSTFAPVTTGMFANGTVEISGAGIT
FT                   EGVTVRVAQ"
     gtgaccgggg ccggggccgg gaccgacgaa accagaaccg gtgagaccag aaccggcgag        60
     acttccgtga ccgccccgcc gacggcagcc gagtacaagg ccggcggccg gtgtgtgccg       120
     agcagggcct gggcgcgggc gatgactgcc tcgtgggcga gcccgctacg gcgccgacca       180
     cgccggcacc tgctcgtcct cgcgggggcg ggagccgccg cgctgatcgt cgccgccgcc       240
     ctgggattcg gcggtagccc gccgccgtcg ccgaccgggc cggttcccgc ggcgaccgcg       300
     acggtccaac gcggcaccct cacccagacc cagcaggtcg gcggtctgat ctcctacggc       360
     gagccggtcg ggctagtcgc ccagcagcaa tccggagtcc tcacctgggt cgcagcgccg       420
     ggcacaacgg tgaagatcgg ccaaccggtg tacgcggtcg acggcaggcc ggtcgtcctc       480
     ctgcacggca ccgcgacgcc gtaccggaca ctcgccacag gcacagtggg ttccgacgtg       540
     aaggagctgg aggccagcct ccaggagctg ggctacaccg gtttcgccgt tgatgacacc       600
     ttcgacgccg ccactgcctc ggccgtgcag gcatggcagg ccaagagcgg gcttcccgcg       660
     caaggcaccg tctcaccgga ccagatcttc gtccacgacg gcgacatccg ggtcgccctc       720
     caggccatcc cggtcggcag ccatctgggc ctgcaaccca accagcaggt cctcacctac       780
     agcggcacca cgcaggtggc atcgatcccg ctggacgtgt cgctgcaaca tctcgtccac       840
     acagacgacc cggcgaccat cgcgcttccg accggtcaac gtctcgacgg cacggtcagc       900
     agcgtcggca ctgtcgcgca gaccattgag gagcagaaca agaccttcgt caccgtgatc       960
     gtgtcgttcg gcgatccctc tgcgctcgcc ggtggcttcg attcgtcgcc ggtgacgttg      1020
     acgatcgtca cggggcagcg ggcgaatgtg ctgaccgtgc cggtgaccgc gctcgtggcg      1080
     aacccggacg gcgggtacgc ggtccagacg gtccagaacg ggcagtcgac gttcgcaccg      1140
     gtgacgaccg gcatgttcgc caacggcacg gtcgagatca gcggtgcggg catcaccgag      1200
     ggcgtcaccg tgcgagtcgc ccagtga                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page