(data stored in ACNUC7421 zone)

EMBL: CP000820.PE84

CP000820.PE84        Location/Qualifiers
FT   CDS_pept        102255..103571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0086"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   lxx:Lxx22040 putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09553"
FT                   /db_xref="GOA:A8LB92"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB92"
FT                   /protein_id="ABW09553.1"
FT                   /translation="MTTARSTTGASPTDAPTQDGTSPTSKSGPATHLGPVPDANLVLRP
FT                   ARLAARELVRVGAAGLRSRPTRVALSALGIAIGIAAMISVIGISSSSREDFHRQIAALG
FT                   TNLLTVSPGQNLFGDQAHLPTEAVTMIGAVGDVESVSATGLVPDARVYRNDHIPAAESG
FT                   SIAVLATRLDLPDTVGADIVAGTYLNEATQRYAAVVLGSTAAAHLGVDSTGPDQQIHLG
FT                   GQWFTVVGILAPVGLAPELDRAALVGWPSAADLLGFDTYPTTLYTRTDPNHVEAVQTLL
FT                   ARTANPAAPNEVDVSRPSDALAAQHAADSTLGGLLLGLGSVALLVGGIGVANTMVISVL
FT                   ERRGEVGLRRALGATRGDIRNQFLAEALLLSTLGGIAGLILGTGVTTCYATTQAWPTVV
FT                   PSWAMLLAFGATLVIGAVAGLYPATRASRLQPTAALAAP"
     atgaccaccg cccgatcaac gaccggtgcc tcaccgaccg acgcacctac tcaggacggc        60
     acctcgccga cgagcaagtc cggacctgcg actcacctag gaccggtgcc ggatgccaac       120
     ctggtgcttc gtccggcccg gctcgcggcg cgggaactgg tccgagtcgg cgccgcaggt       180
     ctgcgctcgc gaccgacgcg tgtcgcgctg tccgccctgg ggatcgcgat cggcatcgcg       240
     gccatgatct cggtgatcgg catctcctcc tccagccggg aggacttcca ccgccagatc       300
     gccgcactcg gtaccaacct gctcaccgtc agccccggcc agaacctctt cggcgaccag       360
     gcacacctac cgaccgaggc agtcacaatg atcggcgcgg tcggcgacgt cgagtcggtc       420
     agcgccacgg gcctggtgcc ggacgccagg gtctaccgca acgaccacat cccggccgcg       480
     gaatccggca gtatcgccgt gctggcaacc aggctggacc tgcccgacac cgtcggagcc       540
     gacatcgtcg ccggcaccta cctcaacgag gcgacccagc gctatgccgc cgtggtcctc       600
     ggatcgacgg cggcggccca cctgggcgtc gactcgaccg gaccggacca gcagatccac       660
     ctcggtggcc agtggttcac cgtggtcggc atcctcgccc ccgtcggcct cgcccccgag       720
     ctcgaccgcg ccgccctcgt cggctggccc agcgccgccg acctgctcgg cttcgacacc       780
     tacccgacca ccctgtacac ccgcacagac cccaaccatg tcgaagccgt acagacgctg       840
     ctcgcccgca cggccaaccc cgcggcgccc aacgaggtcg acgtttcacg tccctccgac       900
     gccctcgccg cacagcacgc ggccgactcc acactcggcg ggctcctgct tggcctcggt       960
     tccgtcgcgc tgctcgtcgg cggcatcggc gtcgcgaaca ccatggtcat ctccgtcctc      1020
     gaacgacgag gcgaggtagg acttcgccgc gcgctcgggg ccacccgcgg ggacatccgc      1080
     aaccagttcc tcgccgaggc gcttctcctg tccacactcg gcgggatagc gggactcatc      1140
     ctcggcaccg gcgtcaccac gtgctacgcc accactcagg cctggcctac cgtcgtcccc      1200
     tcctgggcga tgcttctcgc tttcggtgcc actctcgtca tcggcgcggt cgccgggctc      1260
     taccccgcca cccgcgcctc ccgcctccag cccaccgcag ccctcgccgc gccctga         1317
//

If you have problems or comments...

PBIL Back to PBIL home page