(data stored in ACNUC7421 zone)

EMBL: CP000820.PE85

CP000820.PE85        Location/Qualifiers
FT   CDS_pept        103928..104269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:pnf1300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09554"
FT                   /db_xref="GOA:A8LB93"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB93"
FT                   /protein_id="ABW09554.1"
FT                   /translation="MAVTCRFGGNCVMMYWSDRDISGWGWFAMSMGMLLFWAVLITVAV
FT                   LLVRALIRSDERRRPATRSPSEPGAAHGPAVPSPEEVLADRFARGEIDEQEYRVRLATL
FT                   RDTARFVKH"
     atggctgtca cctgccgctt cggaggtaac tgcgtgatga tgtactggag tgatcgcgat        60
     atcagtggtt ggggctggtt cgccatgtcc atgggcatgc tgctgttctg ggctgtgctc       120
     atcaccgtgg cggtgctgct cgtccgggcc ctgatccgct ccgacgaacg gagacgtcct       180
     gcgacgcgtt cgcccagcga gcccggagct gctcacggac cagccgtacc gtcacccgag       240
     gaagttctgg ctgaccgttt cgcccgaggc gagatcgacg aacaggagta ccgcgtccgc       300
     ttggcgaccc tccgagacac cgcccgtttc gtcaaacact ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page