(data stored in ACNUC7421 zone)

EMBL: CP000820.PE88

CP000820.PE88        Location/Qualifiers
FT   CDS_pept        106678..107595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09557"
FT                   /db_xref="GOA:A8LB96"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB96"
FT                   /protein_id="ABW09557.1"
FT                   /translation="MTSDEEMIERLRGAERTVDVRPSGDLWAGVRARVPGERRRRVARR
FT                   AAPAVACAVAAAGIAAGLTLAGGTGKASLAPADLPPAPRITQLQPVTFTPDEAAHLVIE
FT                   CLQSGPGPADPARFQPGGLTVWAAARDVTGATVILSNPSTFVDCDVPADAAGRLDIDGA
FT                   YVYSWGTGHDAMPRTDLELEHASGSHGIGGGFGGRLGAGFGSGPGDSRTVHDCGGRVSA
FT                   RVARVTATTPSGEIVEVPIQDGKVVVRTLQIDPPEPGPRPGEPGFEDFRRNNPTLFDDW
FT                   YQANRPVVRAYDRDGRLLAATEAG"
     atgacctccg acgaggagat gatcgaacgc cttcgtggcg cggagcgcac ggtggacgtc        60
     cggccgtcgg gtgatctgtg ggccggcgta cgggcccggg ttccggggga gcgccgtcgt       120
     cgggtcgcgc ggcgggccgc cccggcggtg gcgtgcgccg tggccgcggc ggggatcgcg       180
     gccggcctga ccctggccgg tggcacgggg aaggcatccc tcgcgcccgc cgaccttccg       240
     ccggccccgc gaatcaccca gctccagccg gtcaccttca ctccggacga agcggcacat       300
     ctcgtgatcg agtgcctaca gtccggtcct gggccggcgg acccggcgcg cttccagccg       360
     ggcgggctga cggtgtgggc ggcggcgcgg gacgtcaccg gagcgaccgt gattctgtcg       420
     aacccctcga cgttcgtcga ttgcgacgtg ccggcggacg cggcaggtcg actggacatc       480
     gacggggcgt atgtatacag ctgggggacc gggcacgacg cgatgccccg gaccgatctc       540
     gagctggagc acgccagcgg aagtcacggg ataggcggcg gcttcggagg ccgcctcgga       600
     gccggcttcg gtagcggccc cggtgacagt cgcacggtcc atgactgtgg cggacgggtg       660
     tcggcccggg ttgcccgggt caccgcgacg actccgtccg gcgaaatcgt cgaggttccc       720
     atccaggacg ggaaggtcgt ggtcaggacg ctccagatcg atccgcctga gcctggtcca       780
     cggcccggtg agcccgggtt cgaggacttc agacggaaca acccgacgct tttcgacgac       840
     tggtaccagg ccaatcgacc ggtcgtccgg gcctacgacc gggatggccg cctcctggct       900
     gcaaccgagg cgggctga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page