(data stored in ACNUC7421 zone)

EMBL: CP000820.PE89

CP000820.PE89        Location/Qualifiers
FT   CDS_pept        complement(107696..108688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0091"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   sco:SCO5075 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09558"
FT                   /db_xref="GOA:A8LB97"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB97"
FT                   /protein_id="ABW09558.1"
FT                   /translation="MKAAAFARHGGPEVLELMDLATPVAGPGQVRVRLRFAGVQPIDCA
FT                   VRAGWAPPGVAPRLPTIPGNEFAGVVDQVGDRVDGVGGADGADGVGGIDSVGGVDGGDH
FT                   GVVVGAEVLGFGQLGAYAEYLVVPADQVTAKPAGMPWEVAGGFSGGAQTAHIALRELGV
FT                   GKGDTVLIHAAAGGVGTVAVQLAVRAGSTVIGTAGAANHDYLRSLGAIPVAYGDGLVER
FT                   VQAIAPGGVDAALDGAGGDALTASLALVADRSRILTLVEHGRAGELGIRVTPNLRSAAR
FT                   LAELADLQAHGALHINVRRVVPLADAAEAHRELETRHGRGKIVLAVSSG"
     atgaaggcag cggcgttcgc gcggcacggt ggcccggagg ttctcgagct gatggatctg        60
     gccacgccgg tggccgggcc cggccaggta cgggtccggc tccggttcgc cggagtccag       120
     ccgatcgact gcgccgtccg cgcgggctgg gcaccgcccg gggtggcacc ccggctcccg       180
     acgattcccg gcaacgagtt cgccggagtc gtcgaccagg tcggcgacag ggtcgatgga       240
     gtcggcgggg ccgatggggc cgatggagtc ggcgggatcg acagcgtcgg cggcgtcgac       300
     ggcggggatc acggcgtcgt ggtgggcgcc gaggtgctcg gcttcggaca gctgggtgcg       360
     tatgccgagt acctggtggt accggccgac caggtgaccg ccaagccggc cggcatgccc       420
     tgggaggtcg cgggtgggtt cagcggcggg gcacagaccg cccacatcgc gctgcgggag       480
     ctgggcgtcg gcaagggcga caccgtcctg atccacgccg ccgccggcgg ggtcgggacg       540
     gtcgccgtcc aactggccgt acgcgccggc tcgaccgtca tcggcaccgc cggcgcggcc       600
     aaccacgact atctccgctc actgggcgca atcccggtcg cctacggcga cggcctggtc       660
     gaacgcgtcc aggcgatcgc gcccggcggc gtggacgccg cgctggacgg agccggcggc       720
     gacgcgctga ccgcgtcgct ggcgctggtc gccgaccgga gccggatcct caccctcgtc       780
     gagcacggcc gggcggggga gctcggaatc cgggtcacgc ccaacctccg ctcggcggcc       840
     cggctcgccg agctggccga cctccaggcg cacggagccc tgcacatcaa cgtccgccgg       900
     gtcgtcccgc tcgcggacgc cgccgaggcg caccgggagc tggagacgag acacggccgc       960
     ggcaagatcg tcctcgccgt cagcagcggc tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page