(data stored in ACNUC7421 zone)

EMBL: CP000820.PE9

CP000820.PE9         Location/Qualifiers
FT   CDS_pept        15245..15862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL0022 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09478"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB24"
FT                   /protein_id="ABW09478.1"
FT                   /translation="MDVALRQAAEAAKGFMPPEEGLALHAAAAELPGGGLICEIGTYCG
FT                   KSTLYLAAAARLVGAAVVTVDHHRGSEENQSGWEYHDTTLVDPRTGRLDTLPTLRTTLE
FT                   AAGVEDVVTAVVGRSEIVGRWWSTPIDLLFLDGGHTEKQAQADYEAWARHVRPGGRLVI
FT                   HDVFPDPADGGQAPYHVLLRAVRDGFSEMSRTGSLRVLRRLF"
     gtggacgtgg cgttgcggca ggcggccgag gccgccaagg gcttcatgcc acccgaggaa        60
     ggactggcgc tgcacgcggc cgcggccgaa ctgcctggtg gcggactgat ctgcgagatc       120
     ggcacctact gcgggaaatc cactctctac cttgccgccg ccgcccggct cgtcggcgcc       180
     gcggttgtca cggtcgatca tcatcgggga tcggaggaga accagtcagg ctgggagtac       240
     cacgacacca cgctcgtcga cccccgcacc ggccggctgg acacgctgcc cacgctgcgc       300
     acgaccctgg aggccgccgg ggtcgaggac gtcgtcaccg cggtggtagg gcggtccgag       360
     atcgtcgggc ggtggtggtc cacccccatc gacctgctgt tcctcgatgg tgggcacacc       420
     gagaagcagg cgcaggccga ctacgaggcc tgggcccgcc acgtgcgtcc cggcggccgg       480
     ctggtgatcc atgacgtgtt ccccgacccc gctgacggcg gtcaggcgcc gtaccacgtc       540
     ctgcttcgcg ccgttcggga cggcttcagc gagatgtcac gcacgggatc gctgcgggtc       600
     ctccgccggc tcttctga                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page