(data stored in ACNUC7421 zone)

EMBL: CP000820.PE93

CP000820.PE93        Location/Qualifiers
FT   CDS_pept        complement(112875..113852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0095"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mgi:Mflv_2449 alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09562"
FT                   /db_xref="GOA:A8LBA1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LBA1"
FT                   /protein_id="ABW09562.1"
FT                   /translation="MRAAVCREYGQPEVVRVEEFPTPEPQPDQVGVRVRAAAVNYSDVL
FT                   LVAGEYQVKVPPPFVPGSEFAGVVETVGADVTGVAVGDRVFGTGMVGAFGEIAVGRAAS
FT                   LTRTPDGIADTVAAAFGVAHRTSYHMLRSVARLQPGEQLVVLGAGGGVGLAAVQLGAAL
FT                   GATVTAVASSARKLEVAATNGATHLIDHRANDLRKALKETLPDGADVVIDPVGGDLAEP
FT                   ALRSLRWRGRFVTVGYAAGSIPRIPLNLVLLKGIQIGGMQLRDLGTHAPDELQRNEREL
FT                   MELFAAGKAVPHIGASFTFDETAAALRYVADGHAIGKIVLEIAP"
     gtgcgcgccg cggtctgccg cgagtacggc cagccggagg tcgtccgcgt cgaggagttc        60
     cccactcccg agccgcagcc cgaccaggtc ggcgtgcggg tgcgcgcggc agcggtcaac       120
     tactccgacg tcctgctggt cgcgggtgag taccaggtca aggtgccgcc gccgttcgtc       180
     cccggcagcg agttcgccgg tgtcgtcgag acggtcggcg ctgacgtgac cggcgtggcc       240
     gtcggcgacc gcgtgttcgg caccggcatg gtcggtgcct tcggcgagat cgcggtgggg       300
     cgggccgcca gcctcacccg cacgccggac ggcatcgccg acaccgtggc cgccgccttc       360
     ggcgtggcgc accgcacctc gtaccacatg ctccggtcgg tggcccggct gcagcccggc       420
     gagcagctcg tcgtgctcgg tgcgggtggc ggggtgggcc tcgccgccgt ccagctcggg       480
     gcggcgttgg gcgccacggt gacggcggtg gcgtcgtccg cgcgcaaact cgaggtggcg       540
     gccaccaacg gcgccaccca cctcatcgac caccgcgcga acgacctccg caaggcactg       600
     aaggaaaccc tcccggacgg cgccgacgtg gtcatcgacc ccgtcggcgg tgacctggcc       660
     gagcccgcgc tgcgttcgct gcgctggcgc ggccggttcg tcacggtggg ctacgccgcg       720
     ggctcgatcc cgcggatccc gctcaacctg gtgctactca agggcatcca gatcggcggg       780
     atgcagctgc gcgacctggg tacgcacgcg ccggacgagc tccagcgcaa cgagcgggag       840
     ctcatggaac tgttcgccgc gggcaaggcg gtgccacaca tcggcgccag cttcaccttc       900
     gacgagacag cggcggcgct gcgctatgtg gccgacggcc acgccatcgg gaagatcgtc       960
     ctggagatcg ccccgtaa                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page