(data stored in ACNUC7421 zone)

EMBL: CP000820.PE99

CP000820.PE99        Location/Qualifiers
FT   CDS_pept        complement(119884..121128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0101"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swi:Swit_0371 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09568"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8LBA7"
FT                   /protein_id="ABW09568.1"
FT                   /translation="MRNAPDAENSADSADSLQEPVPHQPTVPAPGPQRRPEPADRPDGG
FT                   VLRLDLRIPVPATRGHDQSSQNQSSQHDGADQDGWQIAVTVCLPAPPSPSATGPGADGL
FT                   ETGGLETGGLEPGGLAAGGSGPGVPVLVGLPGGGYARRYFDLPEPGYSQAEHHVRRGAV
FT                   VVMVDHLGVGESSVPPTEVTDLPTVAAAGHHAVTAVVDGLRSGTLTPGVGPVGVSAVIG
FT                   MGQSMGGHILAAMQAHHRTFDGVAILGSSMTATTIPWRPGTPGPVIPEGSSPDEAMAVV
FT                   LASADWIYAFFWEDVPESLVRADSTGGLPGRRTAPVWGSTTYPGLTGAEVLPAGVAEAA
FT                   ASIDVPVLFATGTRDVTGPPLTELAAFSSATDLAWFVAPRMAHMHNFAGTRHLLWNRLD
FT                   AFAAQVTGPRTTRLW"
     gtgcgtaacg cacccgacgc ggagaactcg gcggactcgg cggactcgct ccaggagccg        60
     gtgccgcacc agccaacggt tcccgcgccc ggcccgcagc gacggcccga gccggcggac       120
     cggccggacg gcggcgtgct gcgactcgac ctgcgcatcc cggtacccgc cacgcgcggc       180
     cacgaccaga gcagtcagaa ccagagcagc cagcacgacg gagccgacca ggacggctgg       240
     cagatcgcgg tgaccgtctg cctgcccgcg ccgccatccc cgtccgccac cggccccggc       300
     gcggacggct tggaaacagg cggcttggaa acaggcggcc tggaaccagg cggcttagcc       360
     gcaggcggct ccggcccggg tgtccccgtc ctggtcgggc ttcctggcgg tgggtacgcc       420
     cggcggtact tcgacctgcc cgaacccggc tacagtcagg ccgagcacca cgtccgccgg       480
     ggcgcggtgg ttgtcatggt cgaccacctc ggtgtcgggg agagcagcgt tccgccgacc       540
     gaggtcaccg acctgccgac ggtcgccgcg gccggccacc acgcggtgac ggcggtcgtc       600
     gacggcctgc gttccggcac gctgacgccg ggcgtcgggc cggtcggcgt gtcggcggtg       660
     atcggcatgg ggcagtcgat gggcggtcac atcctggccg ccatgcaggc ccaccaccgc       720
     accttcgacg gcgtggcgat cctgggcagc agcatgacgg cgacgaccat tccgtggcgt       780
     cccggaacgc ccggcccggt gatccccgaa gggtcctccc ccgacgaggc gatggcggtc       840
     gtcctggcgt cagccgactg gatctacgcg ttcttctggg aggacgtgcc ggagtcactc       900
     gtgcgggccg acagcaccgg ggggctgccg ggccggcgga ccgccccggt ctggggcagc       960
     accacctacc cggggctcac cggcgccgag gtactgcccg cgggggtggc cgaggcggcg      1020
     gcgagcatcg acgtcccagt cctgttcgcg accgggacgc gggacgtgac cggtccgcca      1080
     ctgaccgagc tggccgcctt cagttcggcc accgacctcg cctggttcgt cgcgccgagg      1140
     atggcgcaca tgcacaattt cgccggcacc cggcacctgc tgtggaaccg gctggacgcc      1200
     ttcgccgccc aggtgaccgg cccgcgaacc acccggttgt ggtga                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page