(data stored in ACNUC7421 zone)

EMBL: CP000821.PE10

CP000821.PE10        Location/Qualifiers
FT   CDS_pept        complement(11580..12326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0010"
FT                   /product="LamB/YcsF family protein"
FT                   /note="KEGG: slo:Shew_0006 LamB/YcsF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34623"
FT                   /db_xref="GOA:A8FP50"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP50"
FT                   /protein_id="ABV34623.1"
FT                   /translation="MLSNPKGYPIDLNADLGEGSEFDAELLLLITSANIACGGHAGDPL
FT                   SMRKTVIQALKSKVNVGAHPSFPDRENFGRVSIDISGKQLSDSIYQQIMALRAICDELG
FT                   AKLFHVKPHGAFYNEVAKDKVLGRILIDVIKRIDPELKLMILAGSPLVKQARQHGLTVI
FT                   EEAFADRTYLSDGSLAPRSEVGAVIHDPQQALQQVRQIVGNMPVTTLGGQPIIINATSI
FT                   CLHGDNQQALEFAKLISENLTEARKP"
     atgttatcaa atccgaaagg ttaccccata gatctcaacg cagatcttgg tgaaggcagt        60
     gagtttgacg ctgagctgct attacttatc acctcggcaa atatcgcctg tggaggtcat       120
     gccggcgatc ctctgagcat gcgaaagacg gttattcaag cacttaagag caaggtcaat       180
     gttggcgctc accccagctt tcccgatcga gagaattttg gccgcgtgag tatcgatatc       240
     tcaggtaagc aactatcaga ctcaatctat caacaaataa tggcattgag agccatctgt       300
     gatgaactgg gagctaaatt gtttcacgtg aaacctcacg gagcctttta taatgaagtc       360
     gccaaggata aggttttagg acgtatttta attgatgtga ttaagcgaat agacccggag       420
     cttaaattaa tgatcttagc cgggagtccc ttggttaaac aagcccggca acatggactc       480
     acggttatcg aagaggcatt tgccgatcgc acttacctta gtgacggctc actcgctccc       540
     cgcagcgaag ttggcgccgt gatacatgac cctcaacagg cattacagca ggtacgacaa       600
     attgtcggaa atatgccagt gacaacctta ggcgggcaac cgatcatcat aaatgccacc       660
     agcatctgcc tgcatggcga taatcagcag gccctggagt ttgcaaagct gataagtgaa       720
     aatctaaccg aagcaagaaa accgtag                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page